(data stored in ACNUC7421 zone)

EMBL: CP002116.PE71

CP002116.PE71        Location/Qualifiers
FT   CDS_pept        77737..78747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0071"
FT                   /product="Glycerone kinase"
FT                   /EC_number="2.7.1.29"
FT                   /note="COGs: COG2376 Dihydroxyacetone kinase; InterPro
FT                   IPR004006; KEGG: oan:Oant_4368 glycerone kinase; PFAM: Dak
FT                   kinase; PRIAM: Glycerone kinase; SPTR: Glycerone kinase;
FT                   PFAM: Dak1 domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79231"
FT                   /db_xref="GOA:E1R6U9"
FT                   /db_xref="InterPro:IPR004006"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6U9"
FT                   /protein_id="ADK79231.1"
FT                   /translation="MKKFLNAPEAFVDEMLEGIMAAHPDQMSYVNDDIRCVVRKDLSKK
FT                   KVALASGGGSGHLPTFMGYVGEGMLDGCPVGGVFQSPSSDQMYEVTKAIDRGAGVLYIY
FT                   GNYSGDIINFDMAAELADFDDIRVETVVAADDVASAPKSETEKRRGVAGIFYLFKIAGA
FT                   AAEAGMDMDEVKRVAEKVNGRVATMGVALSPCIIPDVGKPSFTIGEDEMEIGMGIHGEP
FT                   GIRRGKLRSADEVVNEILPKLIDDLSPESGSEVSILVNGLGATPKEELYIIYRRIAQVL
FT                   KERGLKPVKIYCGEFATSMEMAGFSISMICLDDELKKFLAAPACTPFFEQGELEL"
     atgaagaaat ttcttaacgc ccctgaggct tttgttgatg aaatgcttga ggggattatg        60
     gctgctcatc ctgatcagat gagctatgtg aatgatgata tccgctgtgt tgtacgaaaa       120
     gacctttcaa agaagaaggt tgctcttgct tcaggcgggg gctccggtca tcttcccacc       180
     tttatgggct atgtgggaga agggatgctc gacggctgcc ctgtcggcgg ggtatttcaa       240
     tcccccagtt ccgaccagat gtatgaagtg accaaagcca tagaccgcgg tgccggggtt       300
     ttgtatatct acggaaacta cagcggggac atcatcaatt tcgacatggc cgccgaactt       360
     gccgacttcg acgatattcg tgtcgagacg gtagtggcag ccgatgatgt tgcctccgcc       420
     ccgaaaagcg aaaccgaaaa gcgtcggggg gttgccggga tcttttatct ttttaaaatc       480
     gccggagccg ccgcggaggc tggaatggat atggatgagg taaaacgggt tgccgaaaag       540
     gtgaacggcc gggttgcaac catgggggtt gccctttcac cctgtatcat ccccgatgtg       600
     gggaaaccct cctttactat cggtgaggat gaaatggaaa tcggcatggg catccatggg       660
     gaaccgggta tcaggcgggg aaagcttcgc agtgccgatg aggtcgtaaa tgagatcctt       720
     ccgaagctta tcgatgatct ttctcccgaa tccggcagtg aggtatcgat tctcgtcaac       780
     ggactcggcg ccaccccgaa agaggagctc tatattatct accgacgtat cgctcaggtg       840
     ttaaaggaac ggggattgaa gccggtaaag atttattgcg gcgagtttgc cacatccatg       900
     gagatggccg gtttttccat ctccatgatc tgtcttgacg atgagctgaa gaaatttctt       960
     gccgcaccag cctgtacccc cttcttcgag cagggagaac tggagttgta g               1011
//

If you have problems or comments...

PBIL Back to PBIL home page