(data stored in ACNUC7421 zone)

EMBL: CP002116.PE72

CP002116.PE72        Location/Qualifiers
FT   CDS_pept        78750..79388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0072"
FT                   /product="Dak phosphatase"
FT                   /note="COGs: COG2376 Dihydroxyacetone kinase; InterPro
FT                   IPR004007; KEGG: oan:Oant_4367 Dak phosphatase; PFAM: Dak
FT                   phosphatase; SPTR: Dak phosphatase; PFAM: DAK2 domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79232"
FT                   /db_xref="GOA:E1R6V0"
FT                   /db_xref="InterPro:IPR004007"
FT                   /db_xref="InterPro:IPR036117"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6V0"
FT                   /protein_id="ADK79232.1"
FT                   /translation="MAERTKERAAVDAVLASISGIMSENREFLIKIDGVIGDGDLGITM
FT                   DKAFSAAAEGVVSLDEPQVPKALIEAGKIMAKNAPSTMGTLMATGFMYGGKALGEEEML
FT                   SAGGLYAFFKGFLEGVEKRGKAKPGEKTLLDVLDPVVRALEAKQEADLSDALEAAMKAA
FT                   EEGLKATEKMVSQHGKAAVYREQTLGKQDPGATAMLFVVKGFREALTTL"
     atggcggaac gaacgaaaga acgtgcggct gtagatgccg tgcttgcctc gatatcgggg        60
     atcatgtcgg agaatcgtga attcctgatc aagatagacg gggtgatcgg cgacggagac       120
     ctcggcatca ccatggataa ggccttttct gctgcggcag aaggggttgt ctccctcgat       180
     gaacctcagg ttccaaaggc cttgatcgag gcaggaaaga tcatggcaaa gaatgccccc       240
     tcgaccatgg gaaccttaat ggccaccggt tttatgtacg gcggtaaggc cctgggtgag       300
     gaagagatgc tcagcgccgg aggcctgtac gcctttttta agggatttct tgaaggggtg       360
     gaaaaacgtg gaaaggcaaa gcccggagaa aagacacttc tcgatgtttt ggacccggtg       420
     gtccgtgcct tggaggcaaa acaggaggcc gacctttcag atgcccttga ggccgcgatg       480
     aaggcggccg aggaaggttt aaaggccacc gaaaagatgg tttcccaaca cggcaaggcc       540
     gccgtttacc gggaacaaac ccttggaaaa caggaccccg gagcaacggc gatgctcttc       600
     gtcgtaaagg gattccggga ggcgcttaca acactgtag                              639
//

If you have problems or comments...

PBIL Back to PBIL home page