(data stored in ACNUC7421 zone)

EMBL: CP002116.PE74

CP002116.PE74        Location/Qualifiers
FT   CDS_pept        80123..80977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0074"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="COGs: COG1595 DNA-directed RNA polymerase
FT                   specialized sigma subunit sigma24 homolog; InterPro
FT                   IPR014284:IPR007627; KEGG: psl:Psta_4074 RNA polymerase,
FT                   sigma-24 subunit, ECF subfamily; PFAM: sigma-70 region 2
FT                   domain protein; SPTR: RNA polymerase sigma factor; TIGRFAM:
FT                   RNA polymerase sigma factor, sigma-70 family; PFAM:
FT                   Sigma-70 region 2; TIGRFAM: RNA polymerase sigma factor,
FT                   sigma-70 family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79234"
FT                   /db_xref="GOA:E1R6V2"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6V2"
FT                   /protein_id="ADK79234.1"
FT                   /translation="MKLSECITAAKAGRYSALEALIKHNQDYLYNLVVRFLGNPLDAED
FT                   AVQEILIKMITRLSSFRGESSFRTWLYRITVNHVLNMKRSKHEEVFTSFEDHKLFIENL
FT                   PDNSLNGLLAYSEEKQQRMAEETKIQCQMGMLLCLERENRIIFILGAVMGIDSLTGSAV
FT                   MDITPETFRKRLSRSRKRLSNYMNGNCSLINTNGVCSCRKKTDILIQKGYVNPENRMFY
FT                   TTHLEKVMEHVKNYSQYADDMLEKRVDDSFREHPWLSLPASIVPLKDIIQSMEVSWDKS
FT                   KLL"
     atgaaattat ctgaatgcat aacggcggcc aaggcgggac gttattccgc tttggaggcc        60
     cttataaaac acaaccagga ctatctatat aatcttgttg tacgtttttt gggaaaccct       120
     ttggatgcgg aagatgctgt tcaggaaatt ttgattaaaa tgattacaag gctttcctca       180
     ttcagaggcg agagtagttt caggacatgg ttgtaccgaa tcacggttaa ccatgtcctg       240
     aatatgaagc gttctaaaca tgaagaagtt tttacttcat ttgaagacca taagcttttt       300
     attgaaaatc ttccggataa ctctttgaat gggctcttag cgtattcgga agaaaaacag       360
     cagcgcatgg cagaagaaac aaaaatacaa tgtcagatgg gaatgttgct ttgtctggaa       420
     cgggaaaatc gaattatctt tatcctgggt gccgtcatgg gaattgattc cctcaccgga       480
     tcggcggtta tggacataac accggaaact tttcgaaaac ggctttcacg ttccagaaaa       540
     cggctatcaa actacatgaa cgggaattgt agtttgatta ataccaacgg cgtttgcagc       600
     tgcagaaaga aaaccgatat tcttatacaa aaaggatatg ttaatcctga aaaccgcatg       660
     ttttatacta ctcatcttga aaaagttatg gaacatgtaa aaaactattc tcaatatgca       720
     gatgatatgc ttgagaaaag ggtcgacgat tcttttcggg aacatccctg gctaagcctt       780
     ccggcttcta tcgttccact taaagatatc atacagagta tggaggtttc ctgggataaa       840
     tcaaagcttc tataa                                                        855
//

If you have problems or comments...

PBIL Back to PBIL home page