(data stored in ACNUC7421 zone)

EMBL: CP002116.PE77

CP002116.PE77        Location/Qualifiers
FT   CDS_pept        83108..83692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0077"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="COGs: COG1309 Transcriptional regulator; InterPro
FT                   IPR001647; KEGG: bpf:BpOF4_12170 TetR family
FT                   transcriptional regulator; PFAM: regulatory protein TetR;
FT                   SPTR: Transcriptional regulator (TetR family); PFAM:
FT                   Bacterial regulatory proteins, tetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79237"
FT                   /db_xref="GOA:E1R893"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:E1R893"
FT                   /protein_id="ADK79237.1"
FT                   /translation="MTGHEKRTLKKKENIKNASIELFSLYGIKKVSMNEIAEKAQVSKV
FT                   SIYKYFNSKDDLIRYVIKAVSSEILSDINNIIESENPFPEKVKMIIMNKNQGLKFLRGD
FT                   FFTELLSLDEVLNNYYEHEFKEKANSLMSKFIELGKTSGFIDKKVKTATILTYIHIFQK
FT                   GVESNIGTLSGRDDISELIQLFFFGILSKQK"
     atgactggac atgaaaaaag aaccttaaag aaaaaagaaa acattaaaaa tgccagtatc        60
     gaattattct cgctttacgg aataaaaaaa gtatccatga acgaaattgc cgagaaggcg       120
     caggtgtcga aggtttctat ctataaatat tttaacagca aggatgattt gattagatat       180
     gttatcaaag ccgtttcttc ggaaatactt tctgatatta ataacataat agaaagtgag       240
     aatccttttc ctgaaaaagt aaaaatgata atcatgaata aaaatcaggg acttaaattc       300
     ctcagaggtg attttttcac cgagcttctg agcctggatg aggttctgaa caattactat       360
     gagcacgaat tcaaggaaaa agcaaacagc ttgatgagca agtttattga attgggtaaa       420
     acttccggat tcatcgataa aaaggtaaaa accgctacca ttttgacata tattcatatt       480
     tttcaaaagg gagttgaatc taatatcgga acattatcag gccgcgatga catctcagag       540
     cttattcagt tgttcttttt cggtattctc tcgaagcaga aatag                       585
//

If you have problems or comments...

PBIL Back to PBIL home page