(data stored in ACNUC7421 zone)

EMBL: CP002116.PE78

CP002116.PE78        Location/Qualifiers
FT   CDS_pept        complement(83815..83964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0078"
FT                   /product="sensor histidine kinase"
FT                   /note="KEGG: ccv:CCV52592_0501 sensor histidine kinase;
FT                   SPTR: Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79238"
FT                   /db_xref="GOA:E1R894"
FT                   /db_xref="UniProtKB/TrEMBL:E1R894"
FT                   /protein_id="ADK79238.1"
FT                   /translation="MNLLINAGILTYINLISIHEMSITTYTYTKDLDLYALKPQWLNSD
FT                   RSLL"
     atgaatctat tgataaacgc aggaatatta acgtacatta acctgataag cattcacgaa        60
     atgtccatta caacctatac ctatacgaag gaccttgatc tgtatgcact aaaaccccag       120
     tggctgaaca gcgaccgttc tcttttatag                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page