(data stored in ACNUC7421 zone)

EMBL: CP002116.PE79

CP002116.PE79        Location/Qualifiers
FT   CDS_pept        84057..84623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0079"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="COGs: COG1309 Transcriptional regulator; InterPro
FT                   IPR001647; KEGG: rpe:RPE_3675 TetR family transcriptional
FT                   regulator; PFAM: regulatory protein TetR; SPTR:
FT                   Transcriptional regulator, TetR family; PFAM: Bacterial
FT                   regulatory proteins, tetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79239"
FT                   /db_xref="GOA:E1R895"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:E1R895"
FT                   /protein_id="ADK79239.1"
FT                   /translation="MSSRPLISACALKLFAERGYDAVGVQEIVDAAGITKPSLYHHFGS
FT                   KKGLLEQLIAPLFQEVNEALARAASYHHDLPRNLDQAAACFFSFAEKQPLFSRLMLSMI
FT                   HAPLKSEARLVVQPWLEEQYHTFENLFRLASGDHGNMKGRSKPFAATFLGMLHTYVSLF
FT                   LDGNTDFDERVRHEAVRQFSYGIYS"
     atgagtagcc gcccacttat tagtgcctgt gccctcaagc tttttgccga acgtggatac        60
     gatgccgttg gagttcagga gatcgtcgat gccgcaggca tcactaaacc gagcctctat       120
     catcatttcg gcagcaaaaa agggctgctg gaacagctta ttgctccctt gtttcaggaa       180
     gtgaacgagg ccctggcccg tgcagcatcg taccatcacg accttccccg aaatcttgac       240
     caggctgcag cttgcttttt ttcctttgcc gaaaaacaac cgctcttttc ccggcttatg       300
     ctttcgatga ttcatgctcc gttaaaaagt gaggcgcgtc ttgtcgtaca gccgtggctt       360
     gaagaacagt accacacctt cgaaaatctc tttcgcctgg cctccgggga tcacggcaat       420
     atgaaaggac ggagcaaacc ctttgccgca acctttctcg gtatgctcca cacctatgtt       480
     tccctttttc tcgacggaaa cacggatttt gatgaacggg tcagacacga ggccgttaga       540
     caattttcct acgggatcta ttcgtaa                                           567
//

If you have problems or comments...

PBIL Back to PBIL home page