(data stored in ACNUC7421 zone)

EMBL: CP002116.PE8

CP002116.PE8         Location/Qualifiers
FT   CDS_pept        5039..6796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0008"
FT                   /product="membrane protein insertase, YidC/Oxa1 family"
FT                   /note="COGs: COG0706 Preprotein translocase subunit YidC;
FT                   InterPro IPR001708:IPR013308:IPR019998:IPR020001; KEGG:
FT                   tde:TDE2396 putative inner membrane protein translocase
FT                   component YidC; PFAM: 60 kDa inner membrane insertion
FT                   protein; SPTR: Inner membrane protein OxaA; TIGRFAM:
FT                   membrane protein insertase, YidC/Oxa1 family; membrane
FT                   protein insertase, YidC/Oxa1 family domain containing;
FT                   PFAM: 60Kd inner membrane protein; TIGRFAM: membrane
FT                   protein insertase, YidC/Oxa1 family, C-terminal domain;
FT                   membrane protein insertase, YidC/Oxa1 family, N-terminal
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79168"
FT                   /db_xref="GOA:E1R6N6"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR019998"
FT                   /db_xref="InterPro:IPR028053"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="InterPro:IPR038210"
FT                   /db_xref="InterPro:IPR038221"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6N6"
FT                   /protein_id="ADK79168.1"
FT                   /translation="MDKRTLLAVILSTIVISVGFMIQNTFFAPPLPESPAVTEQAEASG
FT                   NTNASDGSVSSNDNSQQQPTAPVLQAQGIIPFGDEPGEKMVSLDTKVFKATFSSRGALL
FT                   TSMKLKEHFENGEPLEMIWRGNDAEGAFGISFGGPEREIAHVPFFVRNIDENTLEFYRE
FT                   FAVQTSSGPVPFTLTKRFRFNPSDYLFEVLVKIENSVNAYPALDEDGYAYTLSFGPQIG
FT                   PQVEKMDGRYAYRRYFTYENGKQKNYRMKNGSVSVDNRVSWAAVLGKYFAVIGVPDATD
FT                   YDLLFTEGSEPGLPTTSRLFFSRPPLKSSVSEDVFRFYMGPKISRVLTQYNDPDKNGFG
FT                   TRDLHLEEVMDQGRLLGWLEVIMKKLLVFFYSIIPNWGVAIILLTILVKVVLFPITHKS
FT                   YESTSKMQMLQPKMKEIQDKYRDNPNKMNQEMAELYKREKVNPMGGCLPMLLQMPMFIA
FT                   MYGLFNKYFDLRGSSFIPGWITDLSSPESVYSFAPFKIPILGWSDIRLLPMFFVATMIL
FT                   SSKMTQSPSSAGSQNSSMKMMTYMMPIFFFFFLYNAPSGLLVYWIVTNVLTIGQQKAIS
FT                   KIQKRKEEG"
     atggacaaaa gaactttgct ggcggttatt ctttcaacca ttgttatttc cgtcggtttc        60
     atgattcaaa atacgttttt tgctcctccc cttcccgagt caccggctgt tacagaacaa       120
     gccgaggcct ccgggaatac aaatgcttcc gatggatctg tttcatcgaa tgataattct       180
     caacagcagc cgacggctcc tgttttacag gcccaaggta tcattccttt tggtgatgag       240
     cctggggaga agatggtttc tctcgacaca aaggtattta aagcaacctt cagcagccga       300
     ggggctcttt tgaccagcat gaagttgaaa gagcactttg aaaatggaga gccgctggag       360
     atgatttggc ggggaaacga tgcagagggg gctttcggta tatcttttgg tggaccggaa       420
     agagagatag cacatgttcc gttttttgtc cggaatatcg atgagaatac gctcgaattt       480
     taccgtgagt ttgcagtaca aacctcttca ggtcccgttc ccttcacttt gaccaagcgt       540
     tttcggttta atccttccga ttatcttttc gaggtcttgg ttaagattga gaatagtgtg       600
     aatgcctatc cagccctcga cgaagatggg tatgcctaca cgctatcctt tggtcctcag       660
     attggtcccc aggttgaaaa aatggatggt agatatgcct atcgtcgtta ttttacctat       720
     gaaaacggga aacagaaaaa ttatcgaatg aaaaacggtt ctgtttccgt tgataatcgg       780
     gtaagttggg ctgccgtact tggaaagtat tttgcggtta tcggggttcc cgatgcaacc       840
     gactatgatc ttctttttac cgaaggttcc gagcccggtt tgccgacaac ttcgcgactt       900
     ttcttttcca gacctcctct gaaaagcagc gtaagcgagg atgtttttcg tttttacatg       960
     ggaccgaaga tcagccgtgt cctgacacag tacaacgatc cggataaaaa tggcttcgga      1020
     actcgtgacc ttcatcttga ggaggttatg gaccagggcc gtttgcttgg ctggcttgag      1080
     gtcataatga aaaagttgct tgtcttcttt tattcgatta ttccaaattg gggtgtagcc      1140
     atcattctcc ttaccatttt ggtcaaggtc gtattgtttc cgataacaca taaaagctac      1200
     gaatcgacta gtaagatgca gatgctgcag cccaagatga aggagattca ggataagtat      1260
     cgggacaacc cgaacaaaat gaatcaggaa atggcggagc tttataaacg ggaaaaagtg      1320
     aatcctatgg gaggatgtct tcccatgctt cttcaaatgc cgatgttcat tgccatgtac      1380
     ggccttttta acaagtattt cgatcttcgt ggctcctcgt ttattcccgg ttggattacc      1440
     gacctgtcga gtcccgaatc agtatatagt tttgcaccct tcaaaattcc gattctggga      1500
     tggagcgata tacggttgct tcctatgttt ttcgttgcaa cgatgattct ctccagtaag      1560
     atgacgcaaa gtccctcgtc tgcaggaagc cagaacagta gcatgaagat gatgacctac      1620
     atgatgccta tctttttctt cttctttctc tacaatgctc cctccggtct gctggtttac      1680
     tggattgtta ccaacgtgct gacgataggt cagcagaagg caatctcaaa gatacagaag      1740
     cgtaaggagg aagggtga                                                    1758
//

If you have problems or comments...

PBIL Back to PBIL home page