(data stored in ACNUC7421 zone)

EMBL: CP002116.PE80

CP002116.PE80        Location/Qualifiers
FT   CDS_pept        84638..85978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0080"
FT                   /product="alpha amylase catalytic region"
FT                   /note="COGs: COG0366 Glycosidase; InterPro
FT                   IPR006589:IPR006047; KEGG: hau:Haur_2435 alpha amylase
FT                   catalytic region; PFAM: alpha amylase catalytic region;
FT                   SMART: alpha amylase catalytic sub domain; SPTR: Putative
FT                   uncharacterized protein; PFAM: Alpha amylase, catalytic
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79240"
FT                   /db_xref="GOA:E1R896"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022567"
FT                   /db_xref="UniProtKB/TrEMBL:E1R896"
FT                   /protein_id="ADK79240.1"
FT                   /translation="MSSWWNDARIYHIFPMGFCGAPHTNDFSSPAEHRILKIIDWLDPI
FT                   RRMGFDTILLGPVFESTSHGYDTVDFYHIDRRLGNNESFAGFAEEVHRRGMRLMLDGVF
FT                   NHVGRDFWAFYDLRQKGAASDYVSWFDGVSFSSPGFGDDGFSYTGWEGHQELVQLALSN
FT                   TEVKDHLFGAIRAMRERFGVDGLRLDVAYNLDEGFLRKLAGFCRSLDPDFTLLGEVIHG
FT                   DYGRYLHSNGLDSVTNYECYKGIYSSHNDGNFFEIAWSLNRLFGEEGLCHGLPLFNFVD
FT                   NHDVSRIASILKDRADLPTVYALLCTIPGVPSLYYGSEWESPGVKESGSDWNLRPPAEQ
FT                   IERSGSRLPELIRGLLSLRNGHPALCRGDYRQVHVASRQLAFVRNYGDDWVLILLNSAD
FT                   RSVPIPLKEVPLRELRDTLTGEIAGAQPELGPKSFRIFSTQGPEERV"
     atgagcagct ggtggaacga tgcccggatc taccacatct ttcccatggg gttttgtggt        60
     gcccctcata caaatgattt ctcatctccg gcggaacatc gaatcctgaa aatcatcgac       120
     tggcttgatc ctatacggcg gatgggcttt gataccattc ttctcgggcc ggtttttgaa       180
     tcgacaagcc acggctatga tacggtggac ttctaccata tcgataggcg ccttggcaac       240
     aacgaatcct ttgccggttt tgccgaagaa gtgcaccgcc ggggaatgcg cctgatgctc       300
     gatggggtgt tcaatcatgt aggacgtgat ttctgggcct tctatgacct gcggcaaaag       360
     ggagctgcct ccgactacgt ttcctggttc gacggcgtct ctttttcctc tcctggtttc       420
     ggggacgatg gtttttccta taccggctgg gaagggcacc aggagttggt tcagctggca       480
     ctttccaata cagaggtgaa ggatcatctc ttcggggcta ttcgggcaat gcgggaacgc       540
     ttcggcgtcg atggcctgcg tctcgatgtc gcctacaacc tcgacgaagg gtttcttcgg       600
     aaactggccg gattctgcag gtccctcgat cccgacttta cgctgcttgg tgaggtgatc       660
     cacggagatt acggccgtta tctgcattcg aatggactgg attcggtaac caattatgag       720
     tgctataagg gaatctattc cagccataac gacgggaatt ttttcgaaat tgcctggtcg       780
     ctgaatcgac ttttcggcga agaagggctg tgccacgggt tgccgctgtt caattttgtg       840
     gacaaccacg atgtctcacg cattgcttcc attctgaaag atcgtgcgga tcttcccacc       900
     gtctatgcgc ttctctgcac catacccggt gtgccttcac tctactacgg aagcgaatgg       960
     gagagccccg gtgtgaagga gtcgggatcc gattggaatc tccggcctcc tgccgaacag      1020
     atcgagcgtt ccggctcccg gcttccggag cttattcgcg gacttctctc gcttcgcaat      1080
     gggcatcctg ctctctgccg aggtgactat cgacaggtcc atgtagcctc ccggcaattg      1140
     gcttttgtca gaaattatgg agatgattgg gtattgatac tcctgaattc tgccgatcga      1200
     tcggtgccga ttcctttgaa agaagttccc cttcgggaac ttcgtgatac gctcacagga      1260
     gagatcgccg gtgcccagcc tgagcttggc ccgaaatctt tccgtatctt ttcgacgcaa      1320
     ggcccggagg agagggttta g                                                1341
//

If you have problems or comments...

PBIL Back to PBIL home page