(data stored in ACNUC7421 zone)

EMBL: CP002116.PE81

CP002116.PE81        Location/Qualifiers
FT   CDS_pept        complement(85975..86556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0081"
FT                   /product="pentapeptide repeat protein"
FT                   /note="InterPro IPR001646; KEGG: cli:Clim_1473 pentapeptide
FT                   repeat protein; SPTR: Putative uncharacterized protein;
FT                   PFAM: Pentapeptide repeats (8 copies)"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79241"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:E1R897"
FT                   /protein_id="ADK79241.1"
FT                   /translation="MISEKQYHCDAQFTQNDMVDMDFTDHTFENCSFSNCRFSELRMAG
FT                   TAFISCVFETCEFVVTEIQNVSFNDTLFDACKLLGINFTNCNDFGFSPRFKACLMKTVV
FT                   FNNKNLKSMPFESCEIVDCDFTESDLRDADFSNSFFKGTRFHQCDLRKADFRTARGYEI
FT                   NPITNKIVQARFTLPEAQSFLLFLGIDLGP"
     atgatatcgg agaagcagta ccactgcgat gcgcaattta cccaaaatga tatggttgat        60
     atggatttca ccgatcatac ctttgaaaat tgcagctttt cgaactgtcg cttttccgaa       120
     ttgaggatgg cagggacagc cttcatctcc tgtgtgtttg agacctgcga gttcgtcgtc       180
     acagaaatac aaaacgttag cttcaacgat acactcttcg atgcatgcaa acttttggga       240
     atcaatttca ccaattgtaa tgatttcggc ttttcaccgc gctttaaggc ttgtttgatg       300
     aagacggtcg tcttcaataa caagaatctc aaaagtatgc ctttcgaatc gtgcgagatt       360
     gtagactgcg actttaccga atcggatctc cgggatgccg acttttcaaa ttcctttttc       420
     aaaggcacac gctttcacca atgcgacctg agaaaggcag atttccgcac ggcaaggggc       480
     tacgagatca atcccataac caataaaatc gtacaggcac gttttaccct gccagaagcc       540
     caatcgtttc ttctctttct tggaatcgac ctaggcccct aa                          582
//

If you have problems or comments...

PBIL Back to PBIL home page