(data stored in ACNUC7421 zone)

EMBL: CP002116.PE82

CP002116.PE82        Location/Qualifiers
FT   CDS_pept        86655..87179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0082"
FT                   /product="protein of unknown function DUF107"
FT                   /note="COGs: COG1585 Membrane protein implicated in
FT                   regulation of membrane protease activity; InterPro
FT                   IPR002810; KEGG: tde:TDE1505 hypothetical protein; PFAM:
FT                   protein of unknown function DUF107; SPTR: Membrane protein,
FT                   putative; PFAM: NfeD-like"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79242"
FT                   /db_xref="GOA:E1R898"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="UniProtKB/TrEMBL:E1R898"
FT                   /protein_id="ADK79242.1"
FT                   /translation="MMFFSPPFVWGLIGVLLIAFEMVIPGFTIFFFGAGALLTALVSAV
FT                   VPPVASNIGSQLLLWAVSSVLSFAFLRRHFAKIFRGTVLNRSISNEGLGEVVTVLETIS
FT                   PDKPGRVRYRGTSWKAVSLTETFEPGNKAEIIEISGLTLTVTAPFEGIGRDEFLDRLED
FT                   PSSPKSGETTL"
     gtgatgtttt tttctcctcc ctttgtctgg gggcttatag gtgtattgct catagccttt        60
     gaaatggtta tacccggctt taccatcttc ttttttgggg caggtgctct tttgacggcg       120
     cttgtgtcgg ccgttgttcc tcctgttgcc tccaatattg gaagccagct gttactctgg       180
     gctgtaagtt ccgtactctc ttttgccttt ctgaggcggc attttgcaaa aatttttcgg       240
     ggaacggtac ttaacagatc tatctccaat gagggattag gagaagtcgt tacggttctt       300
     gaaaccattt cccccgataa gccgggaagg gttcgatatc ggggaaccag ttggaaagcc       360
     gttagcttga ccgaaacctt tgagcctggt aacaaggctg aaatcataga aatatcgggg       420
     ctgacactca cggtaacggc tccgtttgag gggatcggcc gggacgaatt ccttgatcgt       480
     ctcgaagatc catcttctcc gaaatccgga gaaactactt tgtga                       525
//

If you have problems or comments...

PBIL Back to PBIL home page