(data stored in ACNUC7421 zone)

EMBL: CP002116.PE83

CP002116.PE83        Location/Qualifiers
FT   CDS_pept        87220..88134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0083"
FT                   /product="band 7 protein"
FT                   /note="COGs: COG0330 Membrane protease subunits
FT                   stomatin/prohibitin homologs; InterPro IPR001972:IPR001107;
FT                   KEGG: tde:TDE0705 SPFH domain-containing protein/band 7
FT                   family protein; PFAM: band 7 protein; SMART: band 7
FT                   protein; SPTR: SPFH domain/Band 7 family protein; PFAM:
FT                   SPFH domain / Band 7 family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79243"
FT                   /db_xref="GOA:E1R899"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR032435"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:E1R899"
FT                   /protein_id="ADK79243.1"
FT                   /translation="MNVILAYLLAFVVIVIFFKLIRIVPEQEVYIIERFGKYEKSLGSG
FT                   LHLVIPFVQRVAYKHTLKEEVIDVDPQVCITADNVQVTVDGLLYLRVMDAEKASYGIDN
FT                   YRYATAQLAKTTMRSEIGKLDLDRSFSERDEINDAIVRAVDEASDPWGIKVTRYEIKDI
FT                   RPTDTIEQAMEQQMRAEREKRAEILASEGEKMSRINISQGDREAAINLSKGERQRRINE
FT                   AEGRSKAIEVTSVATAEGLQMIAEALQLPKGKAAMGLRLAEQYLTKFGSILDTAETTVL
FT                   PDDLARLKSLIDTVAPGIAGGKV"
     atgaacgtta ttttggccta ccttcttgcc tttgtggtca tcgtgatctt ttttaaattg        60
     atcaggatcg tacccgaaca ggaagtgtac atcattgaac gatttggaaa gtacgagaaa       120
     agtctcggct ccggacttca tcttgtgatt ccttttgtcc agcgggtggc ctataagcat       180
     accctgaaag aagaggtgat cgatgtggac cctcaagtct gtattaccgc ggacaatgtc       240
     caggttactg tcgacggact tctctatctt cgtgtaatgg atgcagaaaa ggcgagctac       300
     ggaatcgaca attaccgcta tgcaaccgct cagctggcaa agaccacgat gaggtcggag       360
     atcggaaaac tggatcttga tcgttccttc agtgaacggg atgagatcaa cgatgcaatc       420
     gtccgggccg ttgacgaggc ttccgatcct tggggcatca aggttactcg ttatgagata       480
     aaggatattc gccccaccga taccatcgaa caggcgatgg agcaacagat gcgggcagag       540
     cgggagaagc gggcggaaat tcttgccagc gaaggcgaaa agatgagccg tatcaacatc       600
     tctcagggag accgggaggc tgcgattaac ctttccaagg gagagcgcca gcgtcggatc       660
     aacgaagcgg aagggcgctc caaggcgatt gaggttacca gtgtggccac agccgaaggc       720
     ctacagatga tcgcagaggc gttgcagctt cccaagggaa aggccgccat gggcttgcgg       780
     ctggcggaac agtaccttac caagtttgga tccattctcg atacggcgga aacaacggtt       840
     cttccggatg atcttgccag actcaagtct cttatcgata cggtggcacc gggaatagcc       900
     ggaggtaagg tatga                                                        915
//

If you have problems or comments...

PBIL Back to PBIL home page