(data stored in ACNUC7421 zone)

EMBL: CP002116.PE85

CP002116.PE85        Location/Qualifiers
FT   CDS_pept        89242..90681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0085"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG1626 Neutral trehalase; InterPro IPR019775;
FT                   KEGG: tde:TDE0996 hypothetical protein; SPTR: Trehalase;
FT                   PFAM: Trehalase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79245"
FT                   /db_xref="GOA:E1R8A1"
FT                   /db_xref="InterPro:IPR001661"
FT                   /db_xref="InterPro:IPR004888"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8A1"
FT                   /protein_id="ADK79245.1"
FT                   /translation="MHNSLISKKGFPIVHFYDQDFVDIYEKSWAWIEEAWYRNGEKNGL
FT                   QEQFFRYPGGDTINQAEACMSTFFLVYSNRLFSAFHNLDNFYGKQESDGAIRCTYRIDD
FT                   GNPVLTEENPLGVGPPLFALAEYNLFHKVGNKKRLKEIMPYLEAYYAWLELNFKDDTGL
FT                   YVVPAEASMMENAPRDRAVYLLDFNAQQAVNALYMSAIGDVLNDKEISFRYKRNYFSLK
FT                   TRINSQMWDEESGFYYDLDKEGKRLNEKMIGAYWTLLAEIPNEDKSNALIAHLKNPETF
FT                   GTEHPFPSLAVDSPHFTENGYGCRGSVYPSLNFVVIKGLEKYARYELAREASIRHLYFM
FT                   LDTLHPEGDKKGNLWEAYLPHKEGPALWPDSEDFPRPLYLPGIALSTITLMIENVLGLT
FT                   ISLPRKTVDWIVPTLEIMGIENLSLKRNMITILSNKSSRGWEIRLESEKLYYFTITVLD
FT                   EKKKKTLPIPSGKCSMLIDKL"
     atgcataatt cactaatttc gaaaaaagga ttcccgatcg ttcattttta cgatcaagac        60
     tttgtcgata tttatgaaaa aagctgggcg tggatagagg aagcctggta tcgaaacgga       120
     gagaaaaatg ggctccagga gcaatttttt cgctaccccg gtggagatac gattaaccag       180
     gcagaggcat gtatgtcgac cttcttcttg gtttacagca accgactttt ttccgccttc       240
     cacaacctgg ataattttta cggtaagcag gaaagcgacg gtgctatccg ctgtacctat       300
     cgaatagacg atggtaatcc ggttttaacc gaggagaacc ctcttggggt tggcccgcca       360
     ctttttgcct tggcagaata caatctgttt cataaggtcg gcaataagaa acggctcaag       420
     gagattatgc cttatcttga ggcctactat gcctggcttg agctcaattt taaagatgat       480
     accgggctgt acgtagtacc tgcggaagca tccatgatgg agaatgcacc ccgtgatagg       540
     gcggtctatc tgcttgattt taatgcacag caggccgtta acgcgctcta tatgagtgcg       600
     attggcgatg ttctcaacga caaagagata agttttaggt ataaaagaaa ttatttttct       660
     ctgaagacga gaattaattc tcagatgtgg gatgaggaaa gcggttttta ttacgatctt       720
     gataaagagg gaaagcgcct taacgaaaag atgattggtg catattggac cctccttgcc       780
     gagatcccta atgaggacaa gtctaatgct ctcatcgctc atttgaagaa tccggaaacc       840
     ttcggcacag aacatccctt tccctctttg gctgttgatt ctccccattt cactgagaat       900
     ggatacggtt gtagagggtc tgtctatcct tcgttgaatt tcgtggttat caaggggctt       960
     gagaaatatg cccgctacga gctggccaga gaagcatcta tccggcatct ctattttatg      1020
     cttgatactc tgcatcccga aggtgataaa aaaggaaatt tgtgggaggc ttatcttccc      1080
     cacaaggagg gccctgcact gtggcccgat agtgaggatt ttccgagacc gctctatctg      1140
     ccgggaattg ctctttccac tattaccctg atgatcgaaa atgttcttgg tttgaccatc      1200
     agtttgccaa gaaagaccgt cgattggatc gttcctacct tggagatcat gggaatcgag      1260
     aatctttcgc tcaagcgtaa tatgattacc atcctcagta acaaaagctc gagaggctgg      1320
     gagataaggc ttgagtcgga aaaactctac tatttcacga tcacggtatt ggatgaaaag      1380
     aaaaaaaaga ccctgccgat tccgtcgggt aaatgctcga tgctaatcga caaactatag      1440
//

If you have problems or comments...

PBIL Back to PBIL home page