(data stored in ACNUC7421 zone)

EMBL: CP002116.PE86

CP002116.PE86        Location/Qualifiers
FT   CDS_pept        complement(90683..91270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0086"
FT                   /product="recombination protein RecR"
FT                   /note="COGs: COG0353 Recombinational DNA repair protein
FT                   (RecF pathway); InterPro
FT                   IPR000093:IPR006154:IPR015967:IPR006171; KEGG: tde:TDE1549
FT                   recombination protein RecR; PFAM: TOPRIM domain protein;
FT                   Zinc finger C4-type, RecR; SMART: Toprim sub domain
FT                   protein; SPTR: Recombination protein RecR; TIGRFAM:
FT                   recombination protein RecR; PFAM: Toprim domain; RecR
FT                   protein; TIGRFAM: recombination protein RecR"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79246"
FT                   /db_xref="GOA:E1R8A2"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8A2"
FT                   /protein_id="ADK79246.1"
FT                   /translation="MNQLERLIRSLSRLPGVGRKSAARIAHYLLKADSAFVTRLAEEIG
FT                   TLKERIHPCPVCGNFTEDELCSVCSDPRRDGTQICVVEEPQDVATIESTGEYNGLFHVL
FT                   GGAINPMNGVGPSDLSIDKLVKRASEGTVKEIIIATNPTVEGDTTALYLQNILKERPIE
FT                   VSRLASGLPVGGDLEYADKLTLARSFRGRTKL"
     atgaaccagt tggagcgact catccgaagc ctttccaggt taccgggtgt gggaagaaag        60
     agtgccgcgc gaattgccca ttaccttctc aaagccgatt cggcctttgt tacacggctt       120
     gcggaagaga ttggcacact aaaagaacgc atacatccct gccctgtctg cggaaacttc       180
     accgaggatg aactctgttc cgtctgttct gatcctcgtc gggatggaac acagatctgt       240
     gtggtggaag agcctcagga tgtggcgacc atcgaatcga caggggagta taacggcctt       300
     tttcacgttc ttggtggagc aatcaatccg atgaatggag tcgggccgag cgatctttcc       360
     attgataagc tggtcaaacg ggcatccgaa ggtacggtga aggaaattat catcgcaacc       420
     aatccgacag tcgagggaga taccaccgca ctctaccttc agaacatctt aaaggaacgc       480
     cccattgaag tcagccgcct ggcatccgga ctgccggtag gcggtgacct cgaatatgcg       540
     gacaagctta cccttgcccg ctccttccgg ggacgaacga aactgtaa                    588
//

If you have problems or comments...

PBIL Back to PBIL home page