(data stored in ACNUC7421 zone)

EMBL: CP002116.PE87

CP002116.PE87        Location/Qualifiers
FT   CDS_pept        complement(91272..91604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0087"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG0718 conserved hypothetical protein;
FT                   InterPro IPR004401; KEGG: ddf:DEFDS_0142 hypothetical
FT                   protein; PFAM: conserved hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Uncharacterised
FT                   BCR, YbaB family COG0718; TIGRFAM: conserved hypothetical
FT                   protein TIGR00103"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79247"
FT                   /db_xref="GOA:E1R8A3"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8A3"
FT                   /protein_id="ADK79247.1"
FT                   /translation="MNPMDLFKNMQNLQSGMKDMQEQLKDIVVIGTAGGGMVVIEMNGQ
FT                   MQIIGVRIEREVVDPEDIGMLEDLVRAAFNDAFAKVREEMQNKLSGGLGNLNLPPDLLN
FT                   NLGNPG"
     atgaatccca tggacctgtt caagaatatg caaaaccttc agtccggcat gaaagacatg        60
     caggagcagt tgaaagatat cgtggtaatc ggtactgccg gcggtggcat ggtcgtcatc       120
     gaaatgaacg gacagatgca gatcatcggt gtcagaatcg aacgtgaagt ggtcgatccc       180
     gaagatatag ggatgctgga agatctggtc cgggccgctt ttaacgatgc atttgcaaag       240
     gttcgcgaag agatgcagaa taaactttcc ggcggtttgg gaaatctgaa ccttccgccc       300
     gacctgctta acaatttggg aaaccccggc tga                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page