(data stored in ACNUC7421 zone)

EMBL: CP002116.PE88

CP002116.PE88        Location/Qualifiers
FT   CDS_pept        complement(91601..93346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0088"
FT                   /product="DNA polymerase III, subunits gamma and tau"
FT                   /note="COGs: COG2812 DNA polymerase III gamma/tau subunits;
FT                   InterPro IPR001270:IPR012763:IPR003593:IPR003959; KEGG:
FT                   tde:TDE2586 DNA polymerase III subunits gamma and tau;
FT                   PFAM: AAA ATPase central domain protein; SMART: AAA ATPase;
FT                   SPTR: DNA polymerase III, gamma and tau subunits, putative;
FT                   TIGRFAM: DNA polymerase III, subunits gamma and tau; PFAM:
FT                   ATPase family associated with various cellular activities
FT                   (AAA); DNA polymerase III subunits gamma and tau domain
FT                   III; TIGRFAM: DNA polymerase III, delta' subunit; DNA
FT                   polymerase III, subunits gamma and tau"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79248"
FT                   /db_xref="GOA:E1R8A4"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8A4"
FT                   /protein_id="ADK79248.1"
FT                   /translation="MSYEVTATRKRPQGFETLVGQDFVVSTLSSAVSSGRIAHAYLFSG
FT                   PRGVGKTSAARLLAKALNCEKGPTPAPCGECSSCQEISRGNSLDVIEIDGASNTSVNDV
FT                   REIKDEVLFAPNSGRYKVYIIDEVHMLSNSAFNALLKTIEEPPPYIVFIFATTEIHKVP
FT                   ATIRSRCQQFNFRLIQPETIKNKLAEAAAELQIEAEDEALFWIAKEATGSLRDAYTLFD
FT                   QVASFSDKGITLEEIRQKLGLVGLERINGVAEALAEEDAGKAIELTESVLADGVAVEQF
FT                   IIDLTEYFRNLLFIRHGIKKEAVLGYSPERFSSKARDAWSVSQMETAIELLFTLYREIR
FT                   YSLNQRFELELVMSRLAGMRSYLSPKEVLHQIGKLRSELVEGKLPLGQQQVAGSDNDVP
FT                   ETEPPRSPQIREHAPPQEQVSQAADQSVSQKASNPVHEKSHSDSLSSEEGEEAPPKNSH
FT                   AVVGQTEQAEGPRNLSQEEIQQTIDSLRKTKPALVSALEKAGTWHLEGETLSIDFENGF
FT                   TVNFVRGEIPILADALLPVIGFRPAVKLNAISKEQQQEENDDTEVRLVTEVFRGEVIGP
FT                   KGEKK"
     atgtcatacg aagtaacagc aacaaggaaa cggccccagg gctttgaaac actggttggt        60
     caggattttg tcgtatcgac cctttccagt gcggtttcgt cggggagaat agcccacgcc       120
     tatctttttt ccggcccaag aggtgtcggc aagacctctg cagcacggct tcttgcaaaa       180
     gccttgaatt gtgagaaggg tcctactccc gctccttgcg gggagtgtag cagctgtcag       240
     gaaatctcta gaggtaacag cctcgatgtg atcgagatcg acggtgccag caataccagc       300
     gtcaatgatg tacgggagat taaggacgag gtcctctttg caccaaatag tggtcgctac       360
     aaggtgtata tcatcgacga ggtccacatg ctctccaaca gtgctttcaa tgcgttgctg       420
     aagaccatag aagagccgcc gccctacatt gtctttatct ttgcaactac ggaaattcac       480
     aaggtaccgg cgaccattcg cagccgttgt cagcagttca attttcgcct tattcagccc       540
     gaaacgatca agaataaatt ggccgaagca gccgcggagt tacagataga ggctgaagat       600
     gaggcgcttt tctggattgc caaggaggcg acgggaagcc ttcgggacgc atataccctt       660
     ttcgaccagg tggcctcttt ttcagacaag ggaatcaccc tggaagagat acgccagaag       720
     ctgggactgg taggtctgga acggataaac ggggttgcag aggctttggc ggaagaggat       780
     gccggaaagg ccattgaact aaccgaatcg gtccttgccg acggcgttgc agtagagcag       840
     ttcatcattg atctgaccga atactttcga aatctccttt ttattcgtca cggaatcaaa       900
     aaagaggcag ttctcggcta cagccccgaa cgtttttcgt ccaaggcacg ggacgcatgg       960
     agcgtctctc agatggagac agccatcgag cttctgttta cattgtaccg agaaattcgc      1020
     tacagcctga accaacgctt cgaattagaa ctcgtcatga gccgcctggc cggtatgcga      1080
     agctatctct cccccaaaga agtcctccac caaatcggca aacttcgtag cgagctggtg      1140
     gaagggaaac ttccccttgg tcagcagcaa gtagctggtt ccgacaatga tgttcctgaa      1200
     acagagcctc ctcggagccc gcagattcgc gaacacgccc ccccccaaga acaggtttct      1260
     caagccgccg accaatcggt ctcacagaag gcatcgaacc ctgttcatga aaagtcgcat      1320
     tccgactcgc tatcatccga agaaggcgag gaagcccccc caaaaaacag tcatgccgtt      1380
     gtgggacaaa cagagcaggc agagggacca agaaatctta gccaagagga aattcaacag      1440
     acaattgact ctttacgaaa aacaaagcct gccctggttt cggcattaga gaaggcaggg      1500
     acatggcact tggagggaga aacgctttcc atcgattttg aaaacggctt taccgttaac      1560
     ttcgtacgtg gagagattcc catccttgcc gatgcgctgt tgccggtcat cggatttcga      1620
     ccagcggtca aactcaacgc aatatcaaag gaacagcagc aggaagaaaa tgacgataca      1680
     gaggttcggc ttgtcacaga agtatttcgc ggtgaagtaa tcggcccaaa aggagagaaa      1740
     aaatga                                                                 1746
//

If you have problems or comments...

PBIL Back to PBIL home page