(data stored in ACNUC7421 zone)

EMBL: CP002116.PE89

CP002116.PE89        Location/Qualifiers
FT   CDS_pept        complement(94079..94924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0089"
FT                   /product="apurinic endonuclease Apn1"
FT                   /EC_number="3.1.21.2"
FT                   /note="COGs: COG0648 Endonuclease IV; InterPro
FT                   IPR001719:IPR012307:IPR018246; KEGG: nis:NIS_0286
FT                   endonuclease IV; PFAM: Xylose isomerase domain protein TIM
FT                   barrel; PRIAM: Deoxyribonuclease IV (phage-T(4)-induced);
FT                   SMART: AP endonuclease family 2; SPTR: Probable
FT                   endonuclease 4; TIGRFAM: apurinic endonuclease Apn1; PFAM:
FT                   Xylose isomerase-like TIM barrel; TIGRFAM: apurinic
FT                   endonuclease (APN1)"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79249"
FT                   /db_xref="GOA:E1R8A5"
FT                   /db_xref="InterPro:IPR001719"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR018246"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8A5"
FT                   /protein_id="ADK79249.1"
FT                   /translation="MKYIGAHVSAAGGVEKAPLHAAEIGAGAFALFTKNQRQWKTKPLE
FT                   EHSIKAFSDHLSQVGISPDHVLPHDSYLINLGSPEEEKWQRAFDAFLDEVRRAEQLGLK
FT                   LLNFHPGSHLKKISEEECIGRIAKAMNRAIAETDSLVLVIENTAGQGSNIGYSFEQLGR
FT                   LVELTENKKRVGVCIDTCHAFAAGYDMRSREAYGHTMAHFDEVVGYSYLRGMHLNDAKS
FT                   EFGSRVDRHAPLGDGNIGIEAFRFLMEDSRLDDIPLILETPEPDRWAQEIKTLYDFAGT
FT                   "
     atgaagtata tcggagctca tgttagtgcc gccggcgggg ttgagaaggc cccgctacat        60
     gcggcggaga taggcgcagg ggcttttgcc ctttttacaa aaaatcaacg ccagtggaag       120
     acaaagcccc tggaagagca ttctatcaag gccttctccg accatttatc ccaagtaggg       180
     atcagccccg accatgtgct gccccacgat tcctacctca tcaacttggg ttctccggaa       240
     gaagaaaaat ggcagcgtgc cttcgatgcc tttttggatg aagtaagacg ggccgaacaa       300
     ctcggcctca agctacttaa ttttcacccg ggaagccacc tgaaaaagat atccgaagag       360
     gagtgtatag gacgaattgc aaaggcgatg aacagggcca tagcagaaac cgatagcctg       420
     gttctggtta tagaaaatac cgcaggccag ggttcaaaca taggctacag cttcgaacag       480
     ctgggacggc ttgtggagtt gacggaaaac aagaagcggg tcggagtctg tatcgatacc       540
     tgccacgcat ttgccgctgg gtatgacatg cgcagcaggg aagcttatgg ccataccatg       600
     gcacactttg acgaagtcgt cggctattcc tacctgcggg gtatgcacct gaacgatgcc       660
     aaatccgagt ttggaagtag agttgaccgt catgccccct tgggggacgg aaacatcggc       720
     atcgaggcct ttcgtttcct gatggaagat tccaggctcg atgatatccc cctgattctg       780
     gagacaccgg agcccgatcg ctgggcccaa gaaatcaaga ccctttacga ctttgcagga       840
     acctga                                                                  846
//

If you have problems or comments...

PBIL Back to PBIL home page