(data stored in ACNUC7421 zone)

EMBL: CP002116.PE9

CP002116.PE9         Location/Qualifiers
FT   CDS_pept        6836..7519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0009"
FT                   /product="single-stranded nucleic acid binding R3H domain
FT                   protein"
FT                   /note="COGs: COG1847 RNA-binding protein; InterPro
FT                   IPR001374:IPR004088; KEGG: tde:TDE2395 Jag protein,
FT                   putative; PFAM: single-stranded nucleic acid binding R3H
FT                   domain protein; SMART: single-stranded nucleic acid binding
FT                   R3H domain protein; SPTR: Protein jag; PFAM: R3H domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79169"
FT                   /db_xref="GOA:E1R6N7"
FT                   /db_xref="InterPro:IPR001374"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR032782"
FT                   /db_xref="InterPro:IPR034079"
FT                   /db_xref="InterPro:IPR036867"
FT                   /db_xref="InterPro:IPR038008"
FT                   /db_xref="InterPro:IPR038247"
FT                   /db_xref="InterPro:IPR039247"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6N7"
FT                   /protein_id="ADK79169.1"
FT                   /translation="MVKEFEGKTEKEAIDNAVSALNIDREEFDVEIVESVKGGLFRKGA
FT                   VKIRVFIEDDDDGFDVGDRYSEDVDPQAQDDFEKASVTFLETLIEKMGFPGTVSINFRE
FT                   EKKIGLTIDSQHSGILIGKKGKNLDALQLLVNVYCGKLHEGRRVIVDAENYRSRHEESI
FT                   IRLADRTAAQVRKTKRSRLLEPMNPFERRLVHTTLNDIDDVETRSEGEGLYKQVRIIYK
FT                   GSANY"
     atggtaaaag aattcgaagg aaagaccgaa aaggaggcga tcgataacgc agtttcagca        60
     ctgaatattg accgtgaaga gtttgacgtt gagattgtcg aatccgttaa gggcggcctt       120
     ttccgaaaag gtgcagtaaa gatcagggtt tttattgaag acgacgatga tggctttgat       180
     gtcggcgatc gttacagcga agatgttgat cctcaggccc aagacgattt tgaaaaggcc       240
     tcggtgacgt ttcttgaaac actgatcgaa aagatgggtt ttcctggtac ggtttccatc       300
     aatttcaggg aagaaaagaa aattggttta acgattgatt cccaacattc cggtattctg       360
     ataggaaaaa aaggaaaaaa tcttgatgca ttgcagcttt tggttaatgt gtattgcggg       420
     aagctgcatg agggacgccg agttattgtc gatgctgaga attatcgaag caggcacgag       480
     gaaagcatta tccgtcttgc cgacagaact gcggcacagg tacggaagac taagcgttcc       540
     cggctccttg aaccgatgaa tccctttgaa aggcgattgg tccacactac cttgaatgat       600
     atcgatgatg tggaaaccag gagtgaaggc gaaggccttt ataaacaagt ccggatcatt       660
     tacaagggtt cggcaaacta ttaa                                              684
//

If you have problems or comments...

PBIL Back to PBIL home page