(data stored in ACNUC7421 zone)

EMBL: CP002116.PE90

CP002116.PE90        Location/Qualifiers
FT   CDS_pept        complement(94928..95251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0090"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tet:TTHERM_00046720 TBC domain containing
FT                   protein; SPTR: TBC domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79250"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8A6"
FT                   /protein_id="ADK79250.1"
FT                   /translation="MDTINSLHDTFVQKLPDTIPADLLFKACSQSFLGKELETICGELV
FT                   DTLNADCSKKDYHLWDYDHLEFIIEQARRFHLFLPKNFVNGLPQQFVLRIEADHLYTPE
FT                   CRN"
     atggatacga tcaatagctt acatgacaca tttgtacaaa agcttccgga tactatacct        60
     gccgatctac ttttcaaggc ttgcagccag agtttcttag ggaaggagtt ggaaacgatt       120
     tgtggcgagc tggtggatac tctgaatgcg gactgctcaa agaaagatta ccacctttgg       180
     gactatgatc accttgaatt tattattgag caggcaaggc gctttcatct ttttcttccg       240
     aaaaatttcg tgaacggcct gccgcagcag ttcgttctgc gcatcgaagc cgatcatctt       300
     tacacaccgg aatgtagaaa ctga                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page