(data stored in ACNUC7421 zone)

EMBL: CP002116.PE91

CP002116.PE91        Location/Qualifiers
FT   CDS_pept        95322..96872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0091"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="COGs: COG2509 Uncharacterized FAD-dependent
FT                   dehydrogenase; InterPro IPR006076; KEGG: shi:Shel_15100
FT                   FAD-dependent dehydrogenase; PFAM: FAD dependent
FT                   oxidoreductase; SPTR: FAD-dependent dehydrogenase; PFAM:
FT                   FAD binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79251"
FT                   /db_xref="GOA:E1R8A7"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR028348"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8A7"
FT                   /protein_id="ADK79251.1"
FT                   /translation="MGYKRYQLSLPTDYGEEDLLGLLRKKSGLTEFRYVIEKKSLDARQ
FT                   KREIHWLLSIVLISDQLSGEPWAAPAPLNVPKKRSPCHVVVVGSGPAGIFSALVLAEAG
FT                   CSVTVIERGSRIEKRKRDIDVFEADSTFPLCNNYAFGEGGAGAFSDGKLTSRSKHIGPE
FT                   RAFIHKAFIEAGAPEEIAWLAHPHLGSDNLFRITRALRAKVGTLGGSFAFDTFLEGFTR
FT                   LSGGGFRLSCKKSIGGEGSEIDGIECDYLIIACGHSADDTIAMMIHSGIPYRTKNFALG
FT                   FRVEHEQRVINHAQWGSSSLPGVKAAEYRLTAADNVYTFCMCPGGRVVPAAAFSDRNIV
FT                   NGMSNYYRDGRFANAAVVAGLHPDQLAGRPVSPPEALELLANLERRFVQTGNGYAAPAA
FT                   SISAFLAGKAPGMLPQESSYPFPLIPADPEALYPKFLLPRLRRGLAQFCSKIRGFDTGT
FT                   ILGLESRTSSSVQVLREQDGSIPQFPGLFVVGEASGWAGGIVSSAADGIRAAMTVVGS"
     atgggttata aacgatatca gctatctctt cctaccgatt atggggaaga ggaccttctc        60
     gggcttcttc gcaaaaagag tggcctgacc gaatttcgtt atgtgatcga gaaaaagagt       120
     cttgatgcac gacaaaaaag agaaattcat tggcttctgt ccattgttct catttccgat       180
     caactatcgg gagagccctg ggcagcgcct gcccccctca atgtgcccaa gaagcgtagc       240
     ccctgccatg tggtggtggt cggtagtggc cctgccggaa tattctcggc tttggttctt       300
     gccgaggcgg ggtgttcggt aaccgtcata gaacgcggtt cccggattga aaagcgtaaa       360
     cgcgatatcg atgtctttga ggcagactcg acctttcctc tgtgcaacaa ctatgccttt       420
     ggcgagggag gggctggggc cttttccgac ggcaaactga cctcccggtc gaagcatatc       480
     ggccccgagc gtgcttttat ccataaagcc ttcatcgagg ctggtgctcc cgaagagata       540
     gcctggcttg cgcaccccca tctcggcagc gataaccttt ttcgaataac tcgtgctctt       600
     cgtgccaagg tggggacctt aggaggctct tttgcctttg atacgttctt ggagggattt       660
     acccgtcttt ccgggggcgg ttttcgctta tcatgcaaaa aaagcattgg cggtgaaggt       720
     tcggaaatcg atgggatcga atgtgattat ctgatcattg cctgcggcca ttcggccgac       780
     gataccatcg ctatgatgat tcacagcggg ataccttatc gaacaaaaaa ctttgctctt       840
     ggctttcggg tggagcatga gcagcgtgtc attaatcatg cccaatgggg cagctcctct       900
     ttgcccgggg taaaggctgc ggagtaccgt ctgacggcag cggataatgt ctacaccttt       960
     tgtatgtgtc ccggcggtcg ggtggtaccg gcggcagcct tttccgatcg aaatattgtc      1020
     aatgggatga gtaattatta cagggacgga cgctttgcca atgcggcggt ggttgcaggg      1080
     cttcatccag atcaacttgc cggacgtcca gtctctcctc ccgaggccct ggagctcctt      1140
     gccaaccttg agcgtcgttt tgtgcagaca ggcaatggtt atgcggcacc agccgcctct      1200
     atttcggcct tcctcgccgg aaaggctccg gggatgctgc cccaggagag ctcctatccc      1260
     tttcctctta ttcccgccga ccccgaggcc ctctatccta aatttcttct tccgagactt      1320
     cgtcgtggtc tggctcagtt ctgcagcaag atcagggggt ttgatacggg aaccatcctt      1380
     ggattggaaa gcagaacctc ttcttccgtc caggttctgc gggaacagga tggatctatc      1440
     cctcaattcc ccgggctttt tgtggtgggg gaagcctccg gctgggccgg ggggatcgtg      1500
     agttccgctg ccgacggcat tcgggcggca atgaccgtag tcggatctta g               1551
//

If you have problems or comments...

PBIL Back to PBIL home page