(data stored in ACNUC7421 zone)

EMBL: CP002116.PE92

CP002116.PE92        Location/Qualifiers
FT   CDS_pept        complement(96869..97747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0092"
FT                   /product="histone family protein DNA-binding protein"
FT                   /note="COGs: COG0776 Bacterial nucleoid DNA-binding
FT                   protein; InterPro IPR000119; KEGG: cbc:CbuK_1387 bacterial
FT                   DNA-binding protein; PFAM: histone family protein
FT                   DNA-binding protein; SMART: histone family protein
FT                   DNA-binding protein; SPTR: Bacterial DNA-binding protein;
FT                   PFAM: Bacterial DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79252"
FT                   /db_xref="GOA:E1R8A8"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8A8"
FT                   /protein_id="ADK79252.1"
FT                   /translation="MNNDKQVVETMPKVIEQHLKGLAATLDFVDAEEGFSRLKQAWSEK
FT                   ERLFTGQTRLLEMAEIKELAEDDSRGCILLTNSGSLLSLFPHTGEGRAMEYASIPIRSD
FT                   VPDIIREQDVTYAPSLSVGNPAILHGAPIKKTSPVYRIAVCEEGVSPAEQAKRIREATI
FT                   FLTNGFARINRTIETPMAGKIEHFTKDRMAAYIAGRNDLTQLQVRRILDDFFSVVESGI
FT                   MLGERVSLGSLGKIGYRVRPPSKARIITVPATGEEMTIPAKPSRAVVKFSPSGRLKERA
FT                   EAIPIEEETDD"
     atgaataatg acaaacaagt tgtagaaact atgccgaagg tgattgagca gcatctcaaa        60
     ggcctggcag ccacgcttga ctttgtcgat gccgaagaag ggttttctcg tctaaaacag       120
     gcatggtcgg aaaaggaacg gctttttacc gggcagacaa ggcttctcga aatggccgaa       180
     ataaaggagc tggccgaaga tgattcccgg ggttgtatcc ttcttacaaa ttcaggctct       240
     cttctctcgc tctttcccca tacgggtgaa gggcgggcaa tggagtatgc aagcatcccc       300
     atacgatccg atgttcctga catcatcagg gaacaggatg ttacatacgc tccctccctc       360
     tcggtcggca atcctgcgat cctccatgga gctcccatca aaaagacctc accagtgtat       420
     cgcattgccg tttgcgaaga aggagtatcc cctgcagaac aggctaagag gatcagggag       480
     gccaccattt ttctgaccaa tggctttgca aggattaatc gcaccatcga gacccctatg       540
     gcgggtaaga ttgagcattt tacgaaagat cgcatggcag cctatattgc cgggcgtaac       600
     gacctcaccc aactccaggt ccgcagaatt ctggatgatt tcttctcggt ggtggaaagc       660
     ggcattatgc tgggcgagcg ggtctcgtta ggctccctcg ggaaaatcgg ttaccgtgtg       720
     aggccgccaa gcaaagccag gatcattacc gtcccggcga caggagagga gatgacgatt       780
     cctgcaaagc caagcagagc ggtagttaaa ttctcacctt ccggaagact aaaagaacga       840
     gccgaagcca ttcccataga agaggagacg gacgactaa                              879
//

If you have problems or comments...

PBIL Back to PBIL home page