(data stored in ACNUC7421 zone)

EMBL: CP002116.PE93

CP002116.PE93        Location/Qualifiers
FT   CDS_pept        97861..98385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0093"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ctp:CTRG_05554 hypothetical protein; SPTR:
FT                   Whole genome shotgun sequence assembly, scaffold_14"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79253"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8A9"
FT                   /protein_id="ADK79253.1"
FT                   /translation="MTDGNGIEGKIRDHLKLLVKTAGLPGNEDSLKQLENAWMEKMEAF
FT                   DSEVESRGMEVVDSFFADDERGALLMTYSGSLITLGPMVGAARSAAYRSIGIRNDVPES
FT                   IDSDAASLSGDVEVDSVVSFIDGPIEKSSPIFKIAVVSSDMAEEEQEELLAEATRILTE
FT                   SFVDVNKTIIQ"
     atgacggatg gaaatggtat tgaaggaaag atcagagacc atctcaagct cctggtgaaa        60
     acagccggcc ttcccggtaa cgaagattct ctgaaacaat tggagaatgc ctggatggaa       120
     aagatggagg cattcgatag tgaggtagaa tctcgtggaa tggaggtggt tgattccttt       180
     tttgcggatg atgagcgagg tgctctgctt atgacctatt cagggagcct gattaccttg       240
     ggtccgatgg taggggcggc cagaagtgcc gcctaccgaa gcatcgggat acggaatgat       300
     gttcccgaat cgattgacag cgatgccgct tctctttccg gggatgtaga ggttgattcg       360
     gtcgtatctt tcatcgacgg ccccattgaa aaaagctctc cgatattcaa aattgcggtt       420
     gtttcgagcg atatggctga agaggaacag gaagaacttt tggccgaggc gacgaggatt       480
     cttaccgaaa gctttgtgga cgtgaacaag accatcattc agtag                       525
//

If you have problems or comments...

PBIL Back to PBIL home page