(data stored in ACNUC7421 zone)

EMBL: CP002116.PE94

CP002116.PE94        Location/Qualifiers
FT   CDS_pept        98389..99417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0094"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR006186; KEGG: app:CAP2UW1_3783
FT                   metallophosphoesterase; SPTR: Metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79254"
FT                   /db_xref="GOA:E1R8B0"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8B0"
FT                   /protein_id="ADK79254.1"
FT                   /translation="MFFLPSIVTRRTLPPREAYLHIVKAATDKLKGEDQLVRPRDEHNR
FT                   PGGLIRLQEGITMIVPDLHARIPFLLHALVFPVEGRPFIDLMKEGSGTMVCVGDGLHSE
FT                   ARGYQRWQVALQELLEGFFRHEAMDEEMLEGLGQMELVMRLKLAFPDRFHFLKGNHENI
FT                   LNREGNGDHPFRKFVLEGEMVRVYLQKFYGDDFLKSYADFERALPLVAADGNFMVSHAE
FT                   PARSFSREEVIRYRSLDDVVEGLTWTPNDGSEEGSVQTMIESFCASPDQAVYFGGHRTI
FT                   EGRYSLRASGRFIQLHNPVSFQVALADSGRPFDPERDIVDVSGDPAALLERSELEISEE
FT                   TP"
     atgttttttt tgccttcgat agtcacacgc agaacgcttc ccccccggga agcgtatctg        60
     cacatcgtga aagccgcgac agataaactc aagggagagg accagcttgt acgtccccga       120
     gatgagcata atcgccctgg agggcttatt cgtctgcagg aagggatcac catgattgtc       180
     cccgatctcc atgcaagaat cccctttctc ctgcacgccc tggtttttcc cgtagaaggc       240
     cgacccttta tcgacctgat gaaagagggg tcggggacga tggtctgcgt gggtgacggt       300
     ttgcactccg aagccagagg ctatcagcgg tggcaggtcg ctttgcagga gcttctggag       360
     ggctttttcc gtcatgaagc aatggatgag gagatgctgg agggactggg acaaatggaa       420
     ctggtgatgc ggctgaaact cgcctttccc gatcgtttcc actttctcaa aggaaaccat       480
     gagaatatcc tcaacaggga gggaaacgga gatcatcctt ttcgaaaatt tgttttggag       540
     ggtgaaatgg tccgcgttta tcttcagaaa ttctacggtg atgattttct gaagtcctat       600
     gccgattttg aacgtgcgct tccccttgtt gctgcggatg gtaactttat ggtttcccat       660
     gcagaaccgg cacgctcctt ttcccgtgag gaggtgatcc gttatcgttc gcttgatgat       720
     gtggtggagg gacttacctg gacccctaac gacggctcag aggagggaag tgtacaaacg       780
     atgatagaga gtttctgtgc atcccccgac caggcggtct atttcggcgg gcatcgaacc       840
     atagaaggac gttactccct tcgggcttcg ggacgtttta tccagcttca taatcccgtt       900
     tccttccagg ttgccctggc agattccgga cggcccttcg accctgagcg ggatattgtc       960
     gatgtttctg gggatccggc ggcgctttta gagcgttcgg agcttgaaat atcagaggaa      1020
     acgccatga                                                              1029
//

If you have problems or comments...

PBIL Back to PBIL home page