(data stored in ACNUC7421 zone)

EMBL: CP002116.PE95

CP002116.PE95        Location/Qualifiers
FT   CDS_pept        99414..101030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0095"
FT                   /product="serine/threonine protein kinase"
FT                   /note="COGs: COG0515 Serine/threonine protein kinase;
FT                   InterProIPR020635:IPR002290:IPR017442:IPR000719:IPR 008271;
FT                   KEGG: mxa:MXAN_6317 serine/threonine protein kinase; PFAM:
FT                   Serine/threonine-protein kinase-like domain; SMART:
FT                   serine/threonine protein kinase; Tyrosine-protein kinase,
FT                   subgroup, catalytic domain; SPTR: Serine/threonine protein
FT                   kinase PksC; PFAM: Protein kinase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79255"
FT                   /db_xref="GOA:E1R8B1"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8B1"
FT                   /protein_id="ADK79255.1"
FT                   /translation="MNRPPEMIGKYKIIDLIATGGMGAVYKGVHPTLDCYVIIKKLTLR
FT                   GNPDFAERFRREAKILMDFRNDNIVDIYDHFKEGRSHYIVLEYIDGLSLEQLIRRERYL
FT                   SNDMALYIFREVCKALDYAHKRRVVHRDIKPANILISKKGEVKLVDFGIASSKEEDGEA
FT                   GLTRDGMTLGSPSYMAPEQFENSRNVDQRADIYSLGVMLYESVTGKKPYPGGYTADLIA
FT                   AITKGKHPAPRRLNPKVNRFVSSIVKKTMHPKPRRRYQNLTSLLRRLDRYFHRKPVEAL
FT                   KEQLKKAISGGTLESTPRKKLGKLRRFFSIALPVFFLLFLLLGSAYRSGWYQRLFLADS
FT                   YGELRIALHLDHSYKEPKDLYLRGWLFADTGEDGTALDIDPIHFRLLPSEEREGDLNFV
FT                   SRRVFLPSGDYRLKVQIENNLFWNTFRLHTIKEQHNLYQGEQGRTITLCTSSHTLPLSV
FT                   DFFVQDCDTWVDITPISLIELKTGGRWTPWSDELAEGLTTGSVYRFRISAPGYTEKEFS
FT                   LLIREDQSTLYLNPRLEKSKL"
     atgaatcggc ctccggagat gatcggaaag tataagatca tagatctcat agcaacaggt        60
     ggaatggggg ccgtctacaa gggggtgcac cctacccttg attgttatgt gatcatcaag       120
     aaactgaccc tgcgggggaa tcctgatttt gccgaacgct ttcgtcggga agcaaaaatc       180
     ctcatggatt ttcgcaacga caatattgtc gatatatatg accatttcaa ggaaggacgc       240
     tcccactata ttgtcctcga atatatcgac ggcctttctt tggagcagct tatcaggcgg       300
     gaacgttacc tctcaaacga tatggctctc tacatttttc gggaggtgtg taaggccctc       360
     gattatgccc acaaacgaag ggtcgttcac cgtgatatca aaccggcgaa tattctcatc       420
     tcgaaaaagg gagaggtgaa actggtggat ttcggtatcg cctcttccaa ggaggaggat       480
     ggggaagcgg ggctgactcg ggacggtatg accctgggat ctccctcgta tatggctccc       540
     gagcagttcg aaaatagcag gaatgtcgac cagcgggccg atatctactc tctcggggtg       600
     atgttgtacg agagtgtcac agggaaaaag ccttatcccg gcggttatac cgccgattta       660
     atagcggcga ttaccaaggg aaagcatcct gctccccgtc gccttaatcc caaggtgaac       720
     cgttttgtct cttcgatcgt caaaaagacg atgcatccta aaccaagacg acgttatcaa       780
     aatcttacct ctctgcttcg tcgcctggac cgttacttcc accgtaaacc ggtcgaagct       840
     cttaaggagc agctgaaaaa ggcaatttcc ggaggaacgt tggaatccac tccacgaaag       900
     aagctaggaa agctccgacg ttttttttca atagccctac ccgtgttctt tttattgttc       960
     cttttgctcg gtagtgcata tcgtagcggc tggtaccagc gcctctttct tgccgacagc      1020
     tatggtgagt tgagaattgc cttgcatctg gatcattcct ataaggagcc gaaggatctt      1080
     tacttgcggg gttggctttt tgccgataca ggtgaagacg gaacagccct cgatattgat      1140
     ccgatacatt ttcgtcttct cccctcagaa gagcgggaag gagacctgaa ctttgtcagc      1200
     aggcgggttt tccttccttc aggtgattat cgtcttaagg ttcagataga gaacaacttg      1260
     ttttggaaca cctttaggct ccataccata aaggaacagc ataatcttta ccagggtgag      1320
     cagggacgta ccatcaccct gtgcacaagc tcccatacgc ttccgctttc ggtcgatttt      1380
     tttgttcagg attgtgatac ctgggttgat attaccccga tttcccttat tgaactcaaa      1440
     acgggcggaa ggtggactcc ctggagtgat gagcttgccg agggacttac aaccgggtcg      1500
     gtatatcgat ttcgcatttc tgccccggga tacacagaaa aggaatttag tcttttgatt      1560
     cgggaagatc aaagtacact ctatctcaac ccacgattgg agaaatcaaa actatga         1617
//

If you have problems or comments...

PBIL Back to PBIL home page