(data stored in ACNUC7421 zone)

EMBL: CP002116.PE96

CP002116.PE96        Location/Qualifiers
FT   CDS_pept        101044..101919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0096"
FT                   /product="FHA domain containing protein"
FT                   /note="InterPro IPR000253; KEGG: rrs:RoseRS_3946
FT                   hypothetical protein; PFAM: Forkhead-associated protein;
FT                   SPTR: Putative uncharacterized protein; PFAM: FHA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79256"
FT                   /db_xref="GOA:E1R8B2"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8B2"
FT                   /protein_id="ADK79256.1"
FT                   /translation="MSIGLKRIIIIALGILAGAAAWPLMELVLSFQSLFPGYFIFSIVQ
FT                   GALFGLVLGLFFGSGEGLTSRNGKKLGHGLASGAAVGVIGGVVGFLFGQGVLFFILDKT
FT                   SNYLAVPVARGIGWALLGLFVGAVDGIRVRSLRKTAIGALGGIIGGAAGGAAIELIRLH
FT                   FSELLMIRAVGFILFGLLVGIGYAVAERSFSFGILHVLNGPQRGREYSLSQSSFFVGTS
FT                   SSNDISAEGYHDIEPRHIRFYSKRKELYIKDISGKAGTKVNEEPLRGERLLKYEDVIQV
FT                   GSLKICYLTE"
     atgagtatcg gtcttaaaag aatcattatc atagccttgg gaattcttgc cggtgcggct        60
     gcatggccgc tgatggagct tgtcctttca tttcagtcgc tttttccggg ctattttatc       120
     ttcagcattg tccagggggc cctcttcggt ctcgttctcg gccttttttt cggctcggga       180
     gaggggctga cctcacggaa cggaaagaaa cttggacatg ggcttgcaag tggtgcggcg       240
     gttggagtaa tcggaggggt ggtcggtttt cttttcggcc agggggtgct ctttttcatc       300
     cttgataaaa catccaacta ccttgctgtc cccgtagcaa ggggaatcgg ctgggcgctt       360
     cttgggctct ttgtcggcgc tgtggatggt atcagagtcc gtagcctgag gaagacggca       420
     ataggtgctt tgggagggat tatcggcgga gcggccggtg gggctgccat tgagttgatc       480
     cgtctccatt tttcggagct tcttatgata cgagccgttg gctttatttt gttcggcctg       540
     cttgtgggaa tcggctacgc ggttgccgaa cgaagcttct cctttggtat ccttcacgtt       600
     cttaacgggc ctcagcgggg acgggaatac agcctctccc aatcctcctt ttttgtgggg       660
     acctcttctt ctaacgatat cagtgcagag gggtatcacg atattgagcc tcggcatata       720
     cgtttttatt ccaagagaaa agaactctac ataaaggata tctccgggaa agcagggact       780
     aaggtcaatg aggaaccgct ccggggagag cgcttactaa aatatgaaga tgtgattcag       840
     gtcggttccc tgaagatctg ttatcttacc gaatag                                 876
//

If you have problems or comments...

PBIL Back to PBIL home page