(data stored in ACNUC7421 zone)

EMBL: CP002116.PE98

CP002116.PE98        Location/Qualifiers
FT   CDS_pept        complement(103360..104226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0098"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="InterPro IPR000620; KEGG: gau:GAU_0613 hypothetical
FT                   membrane protein; PFAM: protein of unknown function DUF6
FT                   transmembrane; SPTR: Hypothetical membrane protein; PFAM:
FT                   EamA-like transporter family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79258"
FT                   /db_xref="GOA:E1R8B4"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8B4"
FT                   /protein_id="ADK79258.1"
FT                   /translation="MTHLMLIAAAFIWGINPMIMKIGLATIDPLRYNTLRLLLAFLVSL
FT                   IFVLLGRRWKPVAKEDRKRFIAVGLGGFFIFQGGYTFGVHDTAASISAIILALLPVFVA
FT                   VISIVTRQEKITVKKALGIALSVLGVLAITAGGEAVSVKGTYLRGVLLLVIAEFAYAVY
FT                   TVYVRPLTKRYSIEQIVCIVIFIVLLPFLLISLPVFLRSGLFFPTLAESFSIGYAGTFG
FT                   ILIGNVLWSHGVKRIGSTGTSMYSNLSPIFGVIAGFLVLAERLAPLQIAGGAAVLLGVW
FT                   VVNRKKA"
     atgacccatc tcatgctcat cgccgcggcc tttatctggg gaataaatcc gatgatcatg        60
     aaaataggcc ttgcgaccat tgatcccctt cgctacaaca cccttcgact gctactggct       120
     tttcttgtct ctcttatatt cgttctgctg ggaagacgct ggaagcctgt agcaaaagag       180
     gataggaagc ggttcattgc ggtagggctc ggtggttttt ttatcttcca gggtggctac       240
     acctttggtg tacacgatac ggcggcaagc atttcggcaa ttatcctcgc cttgcttcct       300
     gttttcgttg ccgtcatctc cattgtaacc cgacaggaaa aaatcactgt aaaaaaggcc       360
     ctgggaatag ccctttcggt tctcggtgtg ctggccatta ccgccggagg agaagctgtt       420
     tccgtcaagg gcacctacct tcgaggggtc ctactcctgg tcatcgcaga gtttgcctat       480
     gccgtataca ccgtgtacgt acgcccgctt acaaaacgat attccatcga acaaattgtc       540
     tgtattgtga tcttcatcgt actgctcccc tttctgctga tttcgcttcc cgtttttttg       600
     cggtcgggtc tttttttccc gacgctggct gaatccttca gcatcgggta tgctgggacc       660
     ttcgggattc tgatcggaaa tgtcctttgg agtcatggag taaaacgaat cggcagcacc       720
     ggcacaagca tgtacagcaa tcttagtccg atcttcggtg tcatcgctgg ttttcttgta       780
     ctcgccgagc gcctcgcccc tctccagata gccggaggag cagccgtgct cctcggtgtt       840
     tgggtcgtga acagaaaaaa ggcttag                                           867
//

If you have problems or comments...

PBIL Back to PBIL home page