(data stored in ACNUC7421 zone)

EMBL: CP002116.PE99

CP002116.PE99        Location/Qualifiers
FT   CDS_pept        complement(104240..105202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0099"
FT                   /product="NUDIX hydrolase"
FT                   /note="InterPro IPR000086:IPR020084; KEGG: dat:HRM2_01950
FT                   MutT family protein, putative 78-dihydro-8-oxoguanine
FT                   triphosphatase (8-oxo-dGTPase); PFAM: NUDIX hydrolase;
FT                   SPTR: MutT family protein, putative 78-dihydro-8-oxoguanine
FT                   triphosphatase (8-oxo-dGTPase); PFAM: NUDIX domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79259"
FT                   /db_xref="GOA:E1R8B5"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8B5"
FT                   /protein_id="ADK79259.1"
FT                   /translation="MLAEKLSTPIYYLMLSIMILNLFQRKHMATGEKKRFATLWLAGTL
FT                   LILQIEIGLLAANKQPDWMLIPAFALYAVILFLLRKKIFVFRRTCASCGAPLASREFIG
FT                   RDDNLCANCAPTPEGEEKPEEEKEEKPQPITIAPPEIDEENRHTLGKGTPREEIPRDTD
FT                   GIDWDAWEFAEKAVLCYLFRGDEVLLIHKKTGLGRGLVNAPGGRIEAAEMPMDAAIREM
FT                   QEETGITPKELKEVASLHFIFTDGYSLKGTVFFAYDHEGEARATDEADPFWTPVGEIPF
FT                   DKMWEDDALWLPKVLEGKRVSGYFIFEDEAMVSQKIIES"
     atgcttgctg aaaaactatc aacccctatt tattatctga tgctttcgat catgatcctc        60
     aatctttttc aaagaaagca tatggcaaca ggagagaaga aacgtttcgc caccctgtgg       120
     cttgccggaa ctcttcttat cttacagatc gagatcggac ttctcgcagc gaataaacaa       180
     cccgattgga tgctcattcc cgcctttgcc ctttacgcag tcatcctttt tttgctgaga       240
     aagaagatct ttgtcttccg gcgaacctgc gcctcttgcg gcgcaccttt agccagcagg       300
     gagtttatcg gcagagatga taacctctgt gccaactgcg ctccgacacc ggagggagaa       360
     gagaagccgg aagaggaaaa ggaagagaag cctcagccga taaccatcgc acctccagag       420
     atagatgaag agaaccgtca tacactggga aagggtacgc ctcgagaaga gatcccccgg       480
     gatacagacg gaatcgattg ggatgcctgg gaatttgcgg aaaaagcggt cctctgctat       540
     ctctttcgag gagatgaggt actactgata cataagaaaa cagggctggg caggggcctt       600
     gtaaatgctc ccggcggtag gatagaggca gcggaaatgc ctatggatgc ggcaatccgt       660
     gaaatgcagg aagagaccgg cattacgcca aaagagctga aagaggttgc cagcctccat       720
     ttcatcttca ccgacggcta ttcgctcaaa ggaacggttt tctttgccta tgaccatgaa       780
     ggcgaagcac gagcaaccga tgaagccgat ccattctgga ccccagtggg ggaaatcccg       840
     tttgataaga tgtgggaaga cgatgctctc tggcttccga aagtccttga agggaaaagg       900
     gtttccggct atttcatctt tgaggatgaa gccatggtaa gccaaaagat catcgaatca       960
     taa                                                                     963
//

If you have problems or comments...

PBIL Back to PBIL home page