(data stored in ACNUC7421 zone)

EMBL: CP002157.PE10

CP002157.PE10        Location/Qualifiers
FT   CDS_pept        complement(25269..29078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16181"
FT                   /product="DNA-directed RNA polymerase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16181"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00639"
FT                   /db_xref="GOA:A4AT69"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="UniProtKB/TrEMBL:A4AT69"
FT                   /protein_id="EAR00639.1"
FT                   /translation="MFTNQTERINFASAKNTPEYPDFLDIQIKSFQDFFQLETKSDQRG
FT                   TEGLYNTFMENFPITDTRNQFVLEFLDYFIDPPRYSIQECIERGLTYSVPLKARLKLYC
FT                   TDPEHEDFETIVQDVYLGTIPYMTPSGTFVINGAERVVVSQLHRSPGVFFGQSFHANGT
FT                   KLYSARVIPFKGSWIEFATDINGVMYAYIDRKKKLPVTTLFRAIGFESDKDILEIFDLS
FT                   EEVKVSKAGLKKVLGRKLAARVLNTWHEDFVDEDTGEVVSIERNEIILDRDTVLEKDHI
FT                   EEILGTDVKTILLHKENNAQSDYAIIHNTLQKDPTNSEKEAVEHIYRQLRNAEPPDEET
FT                   ARGIIDKLFFSDQRYNLGEVGRYRMNKKLQLDIGMDKQVLTKEDIITIIKYLIELINSK
FT                   AEIDDIDHLSNRRVRTVGEQLSSQFGVGLARMARTIRERMNVRDNEVFTPIDLINAKTL
FT                   SSVINSFFGTNQLSQFMDQTNPLAEITHKRRLSALGPGGLSRERAGFEVRDVHYTHYGR
FT                   LCPIETPEGPNIGLISSLAVFAKVNPMGFLETPYRKVDGAKVDTKEYMYLSAEEEEGMK
FT                   IAQANIPLKDNGAIDSEKVIAREEGDFPVVDPKEVNYTDVAPNQIASISASLIPFLEHD
FT                   DANRALMGSNMMRQAVPLLKPQSPIVGTGLERQVASDSRVLINAEGDGTIEYVDSQKIT
FT                   IKYKRTDAERLISFDEDEKTYNLVKFRKTNQGTSINLKPIVKKGDKVKKGQVLCEGYAT
FT                   EKGELALGRNLTVAFMPWKGYNFEDAIVISEKVVREDIFTSIHVDEYALEVRDTKLGAE
FT                   ELTHDIPNVSEEATKDLDENGMIRIGAEVKPGDILIGKITPKGESDPTPEEKLLRAIFG
FT                   DKAGDVKDASLKASPSLRGVVIDKKLFSRSIKDKRKRSEDKEAISTLELEYEVKFQQLK
FT                   DVLVEKLFTLINGKTSQGVLNDLGEEVLPKGKKYTMKMLNSVDDFAHLVAGTWTTDKDV
FT                   NHSVADLLHNYKIKLNDLQGNLRRDKFTISVGDELPAGIMKLAKVYVAKKRKLKVGDKM
FT                   AGRHGNKGIVSRIVRQEDMPFLEDGTPVDIVLNPLGVPSRMNIGQIYETVLGWAGLKLG
FT                   RKYATPIFDGATLDEINAYTDEAGIPRFGHTHLYDGGTGKRFDQAATVGVIYMLKLGHM
FT                   VDDKMHARSIGPYSLITQQPLGGKAQFGGQRFGEMEVWALEAYGASATLREILTVKSDD
FT                   VIGRAKTYESIVKGETMPEPGLPESFNVLMHELKGLGLDIRLEE"
     atgttcacaa atcagactga gagaataaat tttgcatccg ctaagaacac gccggagtat        60
     ccggatttct tggacattca gattaagtca tttcaagatt tttttcaact tgaaactaaa       120
     tctgatcaaa ggggcactga aggattgtat aataccttca tggagaactt tccaattaca       180
     gacacgcgta accagtttgt gttggaattt ttagattatt ttatagatcc accaagatat       240
     tccatccaag aatgtataga gcgtggtctt acctatagcg ttccgctaaa agctaggtta       300
     aaattatatt gtactgatcc tgagcatgag gattttgaga ccatcgtaca agatgtgtac       360
     ctaggtacaa ttccttatat gactcctagt ggtacttttg ttatcaacgg ggcagagcgt       420
     gtggttgtat cacagttaca ccgttcacct ggtgttttct ttggacaatc atttcatgcc       480
     aatggaacca agttgtattc tgccagggtt atccctttta aagggtcttg gatagaattt       540
     gctaccgata tcaatggtgt tatgtatgcc tatatcgata gaaagaaaaa attacctgtt       600
     acaacgttgt tcagggcaat aggttttgag agtgataaag acattcttga aatctttgac       660
     ctctccgaag aagtgaaagt ttcaaaggca ggtcttaaaa aagtattggg tcgtaaattg       720
     gctgctaggg tattgaatac atggcatgag gattttgttg atgaagatac tggagaggtt       780
     gtttcaatag aaagaaacga aattatatta gatcgtgata cggttttaga aaaagaccat       840
     atcgaggaga ttttgggtac tgatgtcaaa actattcttt tacataaaga gaataatgcg       900
     caatctgact acgccattat ccataatacg ttacaaaaag atccaacaaa ctctgaaaaa       960
     gaagctgttg aacatatata tcgtcaatta cgtaatgctg agccgccaga tgaggaaacg      1020
     gcacgtggta taattgataa attgttcttt tctgatcaac gttacaactt aggtgaagtt      1080
     ggtcgttata gaatgaacaa aaaattacag ttggatattg gaatggataa gcaggtctta      1140
     accaaagaag atatcattac gataattaaa tatttaatcg agctaattaa ttctaaagca      1200
     gagattgatg atattgacca cctttctaac cgtcgtgtaa gaacagttgg tgagcaattg      1260
     tcttctcagt ttggtgttgg tttggcacgt atggcgagaa ctatccgtga acgtatgaat      1320
     gtacgtgaca acgaggtgtt tactccgatt gatttgatta acgcaaagac attgtcttca      1380
     gttatcaact ctttctttgg aacaaaccag ctttcacagt ttatggatca aacgaatcca      1440
     ttggctgaga ttacccacaa acgtagattg tctgcattag ggccaggagg tctatctaga      1500
     gaaagagcag gtttcgaggt tcgtgatgtt cactatacac actatggaag gttatgtcct      1560
     attgaaactc ctgaagggcc aaatattggt ttgatttctt ctctcgctgt ttttgcgaaa      1620
     gtgaacccaa tgggcttctt ggaaactccg tatagaaaag tagatggagc caaagtagat      1680
     actaaagagt atatgtacct aagtgctgag gaagaggaag gaatgaaaat tgctcaggct      1740
     aacattcccc ttaaggacaa tggtgcaata gattctgaaa aagtaattgc cagggaagaa      1800
     ggtgatttcc ctgttgttga ccctaaagag gtaaactata ctgatgttgc tcctaaccaa      1860
     attgcttcga tttcagcttc gttgattcca ttcttggaac atgatgatgc gaaccgtgca      1920
     ttgatggggt ctaacatgat gcgtcaagca gttccattgc tgaagcctca atcaccgatt      1980
     gtaggtactg gtcttgaaag acaagttgcc tccgattcta gagtattgat aaatgcagaa      2040
     ggcgatggta ctattgagta tgttgattca caaaaaatca ccattaagta caaaagaact      2100
     gacgctgaaa gattaatcag ttttgatgaa gacgaaaaga cgtataactt ggttaagttt      2160
     agaaaaacaa accaaggtac cagtattaac ttaaaaccaa tcgttaagaa aggtgataaa      2220
     gttaaaaaag gacaagttct atgtgaaggt tatgctactg aaaaaggtga actggccttg      2280
     ggtagaaacc ttactgtagc ttttatgcct tggaaaggat ataactttga ggatgcgatt      2340
     gtaatttctg aaaaagttgt acgtgaagat atctttactt caatacatgt tgatgaatac      2400
     gctttagaag taagggatac caaactaggt gctgaggaac taacgcatga tattccaaac      2460
     gtttctgaag aggctacaaa agatcttgat gaaaatggga tgattcgtat tggtgcggag      2520
     gttaaacctg gagatattct tattggtaag attactccaa aaggcgaatc tgacccaaca      2580
     cccgaagaaa aattgttgcg tgctattttt ggtgacaaag caggtgatgt aaaagatgcg      2640
     tcacttaaag cctctccttc gctaagaggt gttgtaattg ataagaaatt attttcaaga      2700
     tctattaaag acaagcgcaa gcgctctgag gataaagagg caatttcaac attggagttg      2760
     gagtacgaag ttaaattcca acagcttaaa gatgtcttgg tggaaaaatt attcactttg      2820
     ataaacggaa agacttcgca aggggtattg aacgatttgg gtgaagaagt tcttccaaaa      2880
     gggaagaagt ataccatgaa gatgcttaac tctgttgatg actttgcgca cttggttgca      2940
     ggaacttgga caacagataa agatgtaaat cattctgttg ctgatttatt gcacaactat      3000
     aagattaagc ttaatgacct acaaggaaac ttgagaagag ataagtttac aatttctgtt      3060
     ggcgatgaat tgcctgcagg aatcatgaag ttggccaaag tttatgttgc taaaaaacgt      3120
     aagcttaagg ttggtgataa aatggctggt cgtcacggta acaaaggtat tgtttcaaga      3180
     atcgtacgtc aagaggatat gcctttctta gaagacggta ctccggttga tatcgtattg      3240
     aatccattgg gtgtaccatc gcgtatgaac attggccaga tttatgaaac tgttcttggt      3300
     tgggcaggtc ttaaattagg tagaaaatat gctactccga tttttgatgg cgcaacttta      3360
     gatgaaatca atgcttacac cgatgaggct ggaattccac gctttggaca tacacactta      3420
     tatgatggtg gtacaggtaa gcgatttgat caggctgcga cggtaggtgt tatttacatg      3480
     ttgaaattag gtcacatggt agatgataag atgcatgcgc gttcaatagg accttactct      3540
     ttaataacgc agcaaccttt aggcggtaaa gcacaatttg gtggtcagcg ttttggagag      3600
     atggaagttt gggctcttga agcatatgga gcatctgcga ctttgcgtga aatattgacc      3660
     gttaagtctg atgatgttat tggtagggcg aaaacttacg agtcaatcgt taagggtgaa      3720
     acaatgccag aacctggttt gccagaatct ttcaatgtat tgatgcacga acttaaggga      3780
     ttaggtttgg acattagatt ggaggaatag                                       3810
//

If you have problems or comments...

PBIL Back to PBIL home page