(data stored in ACNUC7421 zone)

EMBL: CP002157.PE105

CP002157.PE105       Location/Qualifiers
FT   CDS_pept        125028..125792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16656"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16656"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00734"
FT                   /db_xref="GOA:A4ATG4"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATG4"
FT                   /protein_id="EAR00734.1"
FT                   /translation="MRRGSWKIRIFIGLAIVAFAFIQRCNNKEENPYTGRVQNINMTSE
FT                   QEIAIGLQSAPEMAQQHGGLYPDERLQSLVDFVGKKLVDNSIARNTPYKYDFHLLADDR
FT                   TINAFALPGGQIFITYALFSKLNEAQLAGVLGHEIGHVIGRHSAERIADSNFWQTVTMG
FT                   ATVGADAGGIVGSIGQNTLLKNGRGDELESDELGVWFMINSGYEPTEMIEVMKILKAAA
FT                   GPNRVPEFQSSHPDPENRIEKIREAIAKYKGQ"
     atgagaagag gaagctggaa aattagaatt ttcattggtt tggctatagt tgcctttgcc        60
     ttcattcaac gctgtaacaa caaagaagaa aacccatata caggtcgggt acaaaatatt       120
     aatatgacct ctgagcaaga aattgctata ggtttgcaga gtgctcccga aatggcccag       180
     caacatggtg gtctttaccc agatgaacgt ttacaatcat tggtcgactt tgttggcaaa       240
     aagttggtgg ataacagtat tgccagaaac acaccttata aatacgattt tcatttatta       300
     gcggacgatc ggaccataaa tgcatttgca ctaccaggtg gacagatttt tataacctat       360
     gccttgtttt caaagttaaa tgaagcacaa ttggcaggag ttctaggaca cgaaattggc       420
     catgtaatcg gcaggcattc ggctgaaaga attgcggaca gtaatttttg gcagaccgtt       480
     accatgggtg ccacagttgg ggcagatgct ggtggtattg tggggagtat tggacaaaac       540
     acccttttaa aaaatggccg tggtgatgaa ctggaaagtg atgaacttgg tgtctggttt       600
     atgataaact ctggttatga gccaacggaa atgatagaag tcatgaaaat tctaaaggca       660
     gctgccggac ctaatagagt tcctgaattc caaagttctc atcctgatcc tgaaaaccgg       720
     attgagaaaa tcagggaagc catcgcaaaa tacaagggtc agtaa                       765
//

If you have problems or comments...

PBIL Back to PBIL home page