(data stored in ACNUC7421 zone)

EMBL: CP002157.PE106

CP002157.PE106       Location/Qualifiers
FT   CDS_pept        125922..126089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16661"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16661"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00735"
FT                   /db_xref="GOA:A4ATG5"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATG5"
FT                   /protein_id="EAR00735.1"
FT                   /translation="MGTLLHFKNIYTEAFENCKPSFVVLLLKGYSIFCVLMLGMAVYAF
FT                   MYRAFTGFEF"
     atgggaacac ttttacattt taagaacatt tacactgaag cattcgagaa ttgcaaacca        60
     agttttgtag tattactctt aaaaggatac tccatttttt gtgttttgat gctcgggatg       120
     gcggtttatg catttatgta tagggcgttt acaggtttcg aattttag                    168
//

If you have problems or comments...

PBIL Back to PBIL home page