(data stored in ACNUC7421 zone)

EMBL: CP002157.PE112

CP002157.PE112       Location/Qualifiers
FT   CDS_pept        complement(131000..131365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16691"
FT                   /product="Na(+)-translocating NADH-quinone reductase
FT                   subunit F"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16691"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00741"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATH1"
FT                   /protein_id="EAR00741.1"
FT                   /translation="MSTMRPLSEQELHNLAMNIVGKQLEAEGYEFMGVNSKPKKNPQFV
FT                   CLKDKELHFIVVRNVIFPMDPKKYDTELMDKMKDNAQKHNGKVYFAGVGLYNAIDQSLP
FT                   VLLNEKYIVEYDGLIEL"
     atgagtacaa tgagaccact ttcagaacag gaattacata acttggctat gaacatcgtt        60
     ggtaaacagt tggaggcgga gggttatgaa tttatgggag tcaatagtaa acccaaaaaa       120
     aatccacagt ttgtctgctt gaaggataaa gaacttcatt ttattgtggt tcgaaatgtt       180
     atttttccaa tggatccaaa aaagtatgac accgaattaa tggacaaaat gaaggataac       240
     gctcaaaaac ataatggcaa agtgtacttt gcgggggttg ggttatataa tgcaattgat       300
     caaagcctac ccgttttgtt aaatgaaaaa tatatagttg aatatgacgg actcattgaa       360
     ctttag                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page