(data stored in ACNUC7421 zone)

EMBL: CP002157.PE113

CP002157.PE113       Location/Qualifiers
FT   CDS_pept        complement(131461..132768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16696"
FT                   /product="Na(+)-translocating NADH-quinone reductase
FT                   subunit F"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16696"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00742"
FT                   /db_xref="GOA:A4ATH2"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR010205"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATH2"
FT                   /protein_id="EAR00742.1"
FT                   /translation="MILATSTGGTILITVISFLILLLALVALLLFTKEKLSPSGPVTIT
FT                   INGEKKVEVSSGGSLLSTLGNQKIFLPSACGGGGTCIQCECHVLEGGGEALPTETPHFS
FT                   KRELNEGARLACQVKVKQDMNITIPEEVFGIKKWEGTVVRNYNVASFIKEFVVEIPEDM
FT                   GYKAGGYIQIEIPPCEIKYSDIDITAHPEEHETPDKFQAEWDKFNLWPLVMKNPETVER
FT                   AYSMASFPAEGREIMLNVRIATPPWDRSKNGWMDVNPGVASSYIFAQKPGDKVVISGPY
FT                   GEFFINESESEMLYVGGGAGMAPMRSHLYHLFKTLRTNRKVTYWYGGRSKRELFYLDHF
FT                   YQLEKEFSNFKFYLALSEPMEEDNWKVKEDIDAPGDGFVGFIHNCVIDNYLSKHESPED
FT                   IELYFCGPPLMNKAVQKMGEDFGIPDEHIRFDDFGG"
     atgattttag ctacaagtac aggcggaaca attttaataa cggtaatatc tttcctgatt        60
     cttttattgg cgttggtcgc acttttgtta ttcacaaaag aaaaactatc tccttcagga       120
     ccggttacca ttacaattaa tggagaaaag aaagttgaag taagctcagg tggatcatta       180
     ctttcaactt taggaaacca aaaaatattt cttccttcgg cttgcggagg cggtggtacc       240
     tgtatccagt gcgaatgcca tgtactcgaa ggtggtggtg aagcattacc tactgagaca       300
     ccccattttt cgaaaaggga gttaaatgaa ggagctcgtt tggcgtgcca ggtaaaagta       360
     aaacaggata tgaatattac cattcctgaa gaagtattcg gaatcaaaaa atgggagggc       420
     actgtagttc gaaactacaa tgtggcttct tttataaaag agttcgttgt tgaaatccct       480
     gaagatatgg gatataaagc gggggggtat attcagattg aaattccacc ttgtgaaatc       540
     aagtattctg atattgatat tacagcgcat cctgaagaac atgagactcc tgataagttt       600
     caggcggaat gggataaatt caacttgtgg ccattggtaa tgaaaaaccc tgagacggta       660
     gaaagagctt attcaatggc ttcttttcca gcggagggta gagagattat gttgaatgtt       720
     cgtattgcta ctccaccttg ggatagatct aaaaatggat ggatggatgt taatcctggt       780
     gtagcatctt cttacatttt cgcacaaaaa cctggtgaca aagttgttat ttctggacct       840
     tacggtgaat tcttcatcaa tgaatcagaa tctgagatgt tatatgttgg aggtggagca       900
     ggtatggcgc caatgcggtc ccatttatat cacttgttca aaacacttag aacgaataga       960
     aaagtgacat attggtacgg tgggcgttct aaaagagaat tgttctactt ggatcatttc      1020
     tatcagttag agaaagaatt ttcaaatttc aaattttatt tggcactttc agagcctatg      1080
     gaagaggata attggaaagt taaagaagat atagatgctc ctggagacgg ttttgtaggc      1140
     tttatacata attgtgttat tgataattat ttgagcaaac atgagtctcc tgaggatata      1200
     gaattgtatt tctgtggtcc accgttgatg aataaagctg ttcaaaaaat gggcgaggac      1260
     tttggtatcc ctgatgagca tattcgtttt gacgatttcg gcggataa                   1308
//

If you have problems or comments...

PBIL Back to PBIL home page