(data stored in ACNUC7421 zone)

EMBL: CP002157.PE114

CP002157.PE114       Location/Qualifiers
FT   CDS_pept        complement(132771..133517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16701"
FT                   /product="NADH:ubiquinone oxidoreductase, Na translocating,
FT                   E subunit"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16701"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00743"
FT                   /db_xref="GOA:A4ATH3"
FT                   /db_xref="InterPro:IPR003667"
FT                   /db_xref="InterPro:IPR010967"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATH3"
FT                   /protein_id="EAR00743.1"
FT                   /translation="MLEHIELFFRSIFIDNMVFAVFLGMCSYLAVSKKVATAVGLGAAV
FT                   IFVLAVTVPLNWLLDQYLLRDGALAWLGPEYADYNLSFLSFILFIATIATMVQLVEIVV
FT                   EKFSPSLYNSLGIFLPLIAVNCAILGGSLFMQSREIASLGLAFNYGVSSGIGWFLAILA
FT                   IAAIREKIRYSNVPAPLRGLGITFIITGLMGIGFQSFGGMLTGGGEEAAPVKEKTTAEK
FT                   LEKVDKKENNKEIDEKEISYNDAINK"
     atgttagagc atatagaatt attttttaga tccatattta ttgataatat ggtatttgca        60
     gtgtttttag gaatgtgttc ctatttagct gtatcgaaaa aagtagccac cgctgttggt       120
     ttaggtgctg ccgtaatatt cgttttggct gtgaccgttc cattgaactg gttattagat       180
     caatatttat tacgcgatgg tgcattggcc tggttaggac ctgaatatgc cgattataac       240
     cttagcttct tatcttttat tctctttata gccaccattg ctacaatggt tcaattggta       300
     gagattgttg ttgagaaatt ctcaccttca ttatataact ctttaggtat attcttgcca       360
     ttgattgctg taaactgtgc tatcttggga gggtctctat ttatgcaatc cagggaaatc       420
     gcttcattgg gattagcctt taattatggt gttagttctg gtattggatg gtttctggca       480
     attttggcaa tcgccgcaat tcgcgaaaaa atcaggtatt caaatgtccc tgctcctttg       540
     agaggccttg gtatcacttt tattattact ggcttgatgg gaataggttt tcagagtttt       600
     ggtggaatgt tgacaggtgg aggcgaagaa gctgcaccgg ttaaagaaaa aaccactgcg       660
     gagaagcttg aaaaggttga taaaaaagaa aataataaag agattgatga aaaagagatc       720
     tcatataatg acgctataaa caagtaa                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page