(data stored in ACNUC7421 zone)

EMBL: CP002157.PE117

CP002157.PE117       Location/Qualifiers
FT   CDS_pept        complement(134940..136214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16716"
FT                   /product="Na(+)-translocating NADH-quinone reductase
FT                   subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16716"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00746"
FT                   /db_xref="GOA:A4ATH6"
FT                   /db_xref="InterPro:IPR004338"
FT                   /db_xref="InterPro:IPR010966"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATH6"
FT                   /protein_id="EAR00746.1"
FT                   /translation="MSDKRLTLKKRLHILKHHFRDKKMAPAFNAFHTFLFAPDETTHSG
FT                   SHVRGADDLKRTMNTVILALVPVLLFSMFNAGYQHFSAINGFPSEFSLMEHFLTWDNFW
FT                   IGIVKVLPLLVVSYGVGLGVEFIFAVIKGHEVEEGYLVTGMLVPLIVPIDTPLWMLAVA
FT                   VVFGVVIGKEVFGGTGMNILNPALTIRAFLFFAYPTWMSGDKVWVHEAVDRAGTADAIS
FT                   GETVLGFLAQNKGAEMTYSTMDMFYGFIPGSVGETSALLILLGGLFLIFSKIASWRIML
FT                   SAVIGSLVMGLVFNLVVDAEIITETSKFYGLMSFDYWKHLLVGGLAFGIVYMATDPVTG
FT                   AQTNRGKWIYGFLIGFISVMIRVFNPAYPEGVFLAILLMNVFAPTIDHYVVQGNVKKRL
FT                   KRLKNATILPKDSESKAEELKAETV"
     atgagtgata aaagattgac tcttaagaaa aggcttcaca tactaaagca ccattttagg        60
     gataagaaga tggcacctgc attcaatgcg ttccatacat tcttgttcgc accggatgaa       120
     acaacacatt ccggttccca tgtgagaggt gcggatgatt taaagcgtac aatgaacaca       180
     gtgatattgg ccttggttcc ggtattgttg ttttctatgt tcaatgctgg gtatcaacat       240
     ttttcagcga taaacggttt tccgtcggaa ttttcgctta tggaacattt ccttacttgg       300
     gataatttct ggataggaat agtaaaggta ttaccattat tggtggtttc ttacggagtt       360
     ggacttggcg ttgaattcat ttttgccgtg ataaaaggtc atgaggttga agaagggtat       420
     ttggtcacag gtatgttggt tcctctaata gtacctattg atacaccttt atggatgttg       480
     gccgttgccg tagtattcgg tgtggtaatt ggtaaagagg tttttggtgg taccggaatg       540
     aatatcttaa atcctgcatt gactattagg gcctttttgt tcttcgctta cccaacttgg       600
     atgagtgggg ataaggtttg ggttcatgaa gctgttgata gggcaggaac tgccgatgct       660
     atttcaggtg aaacggtatt gggatttttg gcgcagaaca aaggtgctga aatgacctat       720
     tccactatgg atatgtttta tggttttatt ccaggatccg tgggtgaaac ttcagcattg       780
     ttaatccttt taggtggtct gtttttgata ttcagtaaaa tagctagttg gagaattatg       840
     cttagtgcag ttattggctc tttggttatg ggcttggttt tcaatcttgt ggttgatgct       900
     gaaattatta ctgaaaccag taagttctac gggctaatga gctttgatta ttggaaacat       960
     ttattggtgg gtggtttggc ctttggtatt gtgtatatgg ccaccgatcc cgttactgga      1020
     gcacagacta atagaggaaa atggatatac ggatttttaa tcgggtttat ttcggtaatg      1080
     atacgtgttt tcaatccagc ttacccagag ggggttttct tggcaatctt attaatgaac      1140
     gtgttcgcac caactattga tcactatgtt gttcaaggta atgtgaaaaa gcgtttaaaa      1200
     cgacttaaga atgctacgat tttaccgaag gattcggaaa gtaaagcaga agaattaaaa      1260
     gcagaaacag tttaa                                                       1275
//

If you have problems or comments...

PBIL Back to PBIL home page