(data stored in ACNUC7421 zone)

EMBL: CP002157.PE118

CP002157.PE118       Location/Qualifiers
FT   CDS_pept        complement(136218..137567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16721"
FT                   /product="Na(+)-translocating NADH-quinone reductase
FT                   subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16721"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00747"
FT                   /db_xref="GOA:A4ATH7"
FT                   /db_xref="InterPro:IPR008703"
FT                   /db_xref="InterPro:IPR022615"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATH7"
FT                   /protein_id="EAR00747.1"
FT                   /translation="MSKDIRIRKGLNINLVGAAEQTTSKAVLSNVYAINLEDFHGITPK
FT                   MLVKQGAEVKAGQPLFYNKNCEEMMFVSPVSGELVEIVRGARRRIITLKILADKTQTDT
FT                   DNGIFNIENASSKEVKAHLLKSGCWPFVKQRPYDIIANPDANPKAIFVSGYTTAPLAAY
FT                   SDYVLQGKENELQAAITALGKMTPGKVHVSVANSNSPLAGLKGIELHKVSGPHPAGLVG
FT                   TQINKIAPINKGEVVWTVSPQDLVIMGELLLTGKFNSERVVALVGSSVKDPKYFTTKIG
FT                   TEISTFLYGSGVNGENFRVINGDVLTGSKTRPDGYLGYYNNTVTAIPEGDDYELFGWNK
FT                   PIFNKISTTRAMTFSWLQPKKKYDLTTNTNGEHRAFVVTGQYEEVFPMDIFPMQLLKAC
FT                   MVKDLDEMEQLGLYEVAPEDFSLTEFICISKQPHQQIIREGLDLLQKEIG"
     atgtctaaag acattcgaat aagaaagggg ttgaacatta accttgtagg tgctgctgaa        60
     caaacgactt caaaagcggt attaagcaat gtttatgcta taaatcttga agattttcat       120
     ggcataactc caaaaatgct agttaaacaa ggtgccgagg taaaagctgg ccagccttta       180
     ttttataata agaactgtga ggaaatgatg ttcgtttccc cggtgagtgg cgagcttgtt       240
     gaaatcgttc gtggtgctag gagaagaatt attaccttaa aaattctggc agataaaaca       300
     caaaccgata ccgacaacgg tatttttaat atagaaaatg cttcctcaaa agaagttaag       360
     gcacatttgt tgaaatctgg gtgttggcca tttgtaaaac aaagaccata tgatattatt       420
     gcaaatcctg atgcaaatcc aaaagcaatt ttcgtttcag gatatacaac agcaccttta       480
     gcggcatata gcgattatgt gcttcaagga aaagagaatg aacttcaagc ggctattacg       540
     gctttaggaa aaatgacacc tggtaaggtt catgtttctg ttgcaaattc taattcacct       600
     ttggcaggat taaaaggaat agagcttcat aaagtttctg gtcctcaccc tgctggtttg       660
     gtaggaactc aaattaacaa aatagcccct atcaataaag gtgaggttgt ttggacggtt       720
     tctcctcaag atttggtgat aatgggtgaa ctgcttttga ccgggaaatt caattcagaa       780
     cgtgttgttg ccttggtggg ctcctcagta aaggatccaa aatatttcac aacaaaaatc       840
     ggaacggaga tatctacctt cctgtatgga agtggcgtga acggtgagaa ctttagagta       900
     atcaatggtg atgttctaac aggctcaaaa accagacctg atgggtattt aggttattat       960
     aacaataccg ttaccgctat tccagaagga gatgactatg aactgtttgg ttggaacaaa      1020
     ccaattttca ataaaatatc tactacaaga gcaatgacct tttcttggtt acaacctaag      1080
     aaaaaatacg atcttacaac aaacaccaat ggtgaacaca gggcatttgt tgtaacaggg      1140
     caatatgaag aagtttttcc aatggatatt tttcccatgc aattattaaa agcatgtatg      1200
     gtaaaagatc ttgatgagat ggaacaattg ggactatatg aagtggctcc tgaggatttt      1260
     tcattaactg aatttatttg catttcaaaa caacctcacc aacagattat tcgagaaggg      1320
     ttggatttat tacaaaaaga aataggctaa                                       1350
//

If you have problems or comments...

PBIL Back to PBIL home page