(data stored in ACNUC7421 zone)

EMBL: CP002157.PE123

CP002157.PE123       Location/Qualifiers
FT   CDS_pept        complement(142604..143269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16746"
FT                   /product="glucose-inhibited division protein B"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16746"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00752"
FT                   /db_xref="GOA:A4ATI2"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATI2"
FT                   /protein_id="EAR00752.1"
FT                   /translation="MLFLPNTKVRMKAELVFKYFPNLSEAQKTQFIRLEELYKDWNLKI
FT                   NVVSRKDIDELYLRHVLHSLGIAKIQEFKPGASILDVGTGGGFPGIPLAILFPEADFTL
FT                   VDSIGKKVKVVQEVVEGLGIENVTSINSRVEEVNGRYDFIVSRAVAAMPTFVHWVKGKI
FT                   KKESVHDRRNGILYLKGGDLSEELKDYKNAQTYDLPAYFTEDFFETKKVVYLPLKYKG"
     atgctatttt tgccaaatac aaaggtaaga atgaaagctg aattagtatt taaatatttt        60
     cccaatttat ctgaagccca aaaaacccag tttattcgtt tagaagagct ttacaaggac       120
     tggaatctga aaattaatgt agtatcccga aaagatattg atgagttgta cttgcgacat       180
     gtcttgcatt cacttggaat cgccaaaatt caggagttta aacctggtgc ttcaatattg       240
     gatgttggaa ctggaggggg atttccaggt atacctttgg ccatattgtt tccggaagct       300
     gattttacac ttgtagattc tattggtaaa aaagtaaagg tggtccaaga ggttgttgaa       360
     ggcctgggaa ttgaaaatgt aacctcaatc aatagtaggg ttgaggaggt taatggccga       420
     tacgatttta ttgtaagtag ggcggtggcc gcaatgccaa catttgtgca ttgggtaaaa       480
     ggaaaaataa agaaagaatc agttcatgat agaagaaatg gaatacttta cctaaaagga       540
     ggggatttgt cggaagaact taaagactat aaaaatgcgc agacatatga cttgcccgcc       600
     tatttcacgg aggacttttt tgaaacgaaa aaagtcgtgt atttaccttt gaaatataaa       660
     ggataa                                                                  666
//

If you have problems or comments...

PBIL Back to PBIL home page