(data stored in ACNUC7421 zone)

EMBL: CP002157.PE127

CP002157.PE127       Location/Qualifiers
FT   CDS_pept        complement(147209..148558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16766"
FT                   /product="putative potassium uptake protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16766"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00756"
FT                   /db_xref="GOA:A4ATI6"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATI6"
FT                   /protein_id="EAR00756.1"
FT                   /translation="MKIIIAGAGEVGFHLAKLLSYESQDITLIDTDKESLMYADNHLDI
FT                   RVLRGDATSISILEDAQVKDCSLVIGVTSSQTTNITFCMLAKQLGCKRTIARISNTEFI
FT                   EHKERIRFSELGIDELISPEELAAEEIRMLLNKSAFNDTYEFEDGKLIMVGVSLQKSAP
FT                   FVGKMVKEAAMIFPELHFMPIALQRTGTQFTVIPRGDTVFKEGDQVYFIITPEGVDELY
FT                   KLTDKKKEDIKNVMILGGSKVGFKSARDLCTKKFNVKLIEKNKEKAFDLADELPNALVI
FT                   NGDGRNVELLEEESLDSMDAFIAVTGNSETNIMSCLVAKSKHIKKTIALVENMDYFQLS
FT                   HSIGIDTLINKKLLAANNIFKYIRKGEVVALMRLNNINAEILEFVVKPKSKVTGSIIRE
FT                   LDIPKTATIGGVVRNGKGIIALGGFEIKAGDRVVVCCLPNAIPIIEKLFL"
     atgaaaatta ttattgccgg tgcaggtgaa gtaggatttc acttggcaaa acttctctcc        60
     tacgaatctc aggatattac ccttatcgac accgataagg agagtttaat gtatgcggac       120
     aatcatttgg atattagggt tctccgaggg gatgctactt caatatcaat attggaagat       180
     gctcaagtaa aggattgctc gttggtgatt ggagtaacat catcccagac aaccaacatc       240
     actttttgta tgcttgccaa acaattggga tgtaaacgta ccatcgcaag gatttcaaat       300
     actgaattta ttgaacataa agagcgtatt agattttctg aattgggaat tgatgaattg       360
     atttcaccag aggagttggc tgcggaagaa attcggatgc ttttgaacaa atctgccttc       420
     aatgacacct atgaatttga ggatggtaaa ttgataatgg taggggtttc actacagaaa       480
     agtgcacctt ttgttgggaa aatggtgaaa gaagcggcaa tgatattccc cgagcttcat       540
     tttatgccta ttgcccttca aagaactgga actcaattta cggttatacc gaggggagat       600
     actgttttta aagaaggtga tcaagtttat tttatcataa cgccagaagg ggttgatgag       660
     ttatataaac ttaccgataa gaagaaagag gatatcaaga atgtaatgat tttgggagga       720
     agtaaagttg gcttcaaatc ggcacgagat ctttgcacaa aaaaattcaa cgtaaagctt       780
     attgaaaaaa ataaggaaaa agcttttgac cttgcagatg aacttccaaa tgccttggtt       840
     attaatggag acggaagaaa tgttgaactt cttgaagagg aaagcctgga ttctatggat       900
     gcctttattg ccgttacagg gaattctgaa accaatataa tgtcttgttt agttgcgaaa       960
     tcaaaacata ttaagaagac catagcactg gttgaaaata tggattactt tcaactatcc      1020
     cattccatag gaattgatac gttaatcaat aaaaaacttt tggccgccaa caacattttc      1080
     aaatacataa gaaaaggaga agtggttgcc ttaatgcgtt tgaataatat caatgccgaa      1140
     attttggaat ttgtggttaa accaaaatct aaggtcacag gttctattat aagggagctc      1200
     gatattccga aaactgcaac tattggtggt gtggtaagaa atgggaaggg aattattgcc      1260
     ttgggtggtt ttgagataaa agcaggggat agggtagtgg tctgttgttt gcccaatgcc      1320
     attccgataa ttgaaaaact tttcctctaa                                       1350
//

If you have problems or comments...

PBIL Back to PBIL home page