(data stored in ACNUC7421 zone)

EMBL: CP002157.PE131

CP002157.PE131       Location/Qualifiers
FT   CDS_pept        150953..153616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16786"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16786"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00760"
FT                   /db_xref="GOA:A4ATJ0"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATJ0"
FT                   /protein_id="EAR00760.1"
FT                   /translation="MAFTNHANNVFLISMRIVFRFKNPYAKISLLFFAITLVSCNALKK
FT                   VDDGELLLTGNTIYADEEKVNDEDIQSLIIQEPNSTLLGYPLRLNLYNLAKQNPDSLFQ
FT                   DWLYRKEKRRKRLANILSEKQVDRLGESFLVKGMSEWLKNIGEPPAIIDTLDTQRTLER
FT                   LKAYYNSKGYFNNNTTYAIDSLKRPKRAAIDYKITLGEPYVIDSISDIISSKVIDSIYQ
FT                   LNKKQSLIKKGKQFDFLDFDNERKRLTALFRNSGIRNFQESSVNFAITRDSTKSGTNKK
FT                   TDIAINIDNLRTRNDNTISSSEYKVERFKQINIYTDFILSGDEEQNNVVKYGNYNIYYK
FT                   DKLRFKPKTLTDAIFFEKDSIYRESDRSSTYRRITSLNVFKYPSIAFDTDSLSGLSANI
FT                   YLTERPKYSLGMELDVSHSNIQQVGMAFSPSLQVRNLFKGAENFSLTGRMNIGSSKDES
FT                   IRASDSHFFNLLEFGADVNLTFPRIWFPFIKTDKIIPNYTLPQTRLSLGASSQKNIGLD
FT                   KWTFNTVLGYNWTPSDFKKHNVELLNIQFVDNLKPYRFFNVYQNSYDRLNEIANKYDEA
FT                   NEFDDPNDYETFSGFYEPSDDPNDPDLSIPSGTDGFIDEITDNTVPVSTDDLNEVRSIE
FT                   ERRDRLTENNLIFATNYSFSKHNQNGITDNSFHRFRFKVESAGNLLSALSYVIPFNEKD
FT                   GDLLVFDVPYSQYIKTEFDYIKYWDLSRSNVLAFRSFFGIAIPYGNSDNIPFVRSYFAG
FT                   GSNDNRAWNPYSLGPGKTNEINDFNEANLKLAFNLEYRFPVVGDIKGALFADAGNIWNV
FT                   FDNEDDPDKTFNGIDSLTDIALGTGFGVRYDFTYFLIRVDLGFKTYNPAEEISKRWFRD
FT                   YNFANSVLQIGINYPF"
     ttggctttta ccaaccatgc aaataatgta tttttgattt ctatgaggat agtgtttcgt        60
     tttaaaaatc cctacgctaa aataagctta ttattttttg cgattacgct tgtctcttgt       120
     aatgccctga aaaaagtaga tgatggcgaa ttgcttttaa ctgggaatac aatatatgca       180
     gatgaggaaa aagtaaacga tgaggatata caaagtctaa ttatccaaga accaaatagc       240
     acattattag ggtatccgct aagattaaat ttatataatc ttgctaaaca gaatcctgat       300
     tctttatttc aagattggct ctatcgaaaa gagaaaagaa ggaaaagact tgcgaacata       360
     ctttccgaaa aacaggtgga taggctaggc gaatcatttc tagtaaaagg aatgagcgaa       420
     tggcttaaaa acattgggga accaccagca attattgata ctttggacac ccaaagaaca       480
     ttggagcgtc tgaaagccta ctacaatagt aaaggatatt ttaataacaa taccacatat       540
     gcaatagact ccttgaagcg gccaaaaaga gctgcaatag actataagat tacattaggc       600
     gaaccttatg tcattgattc tatttcagac ataatatcct ctaaagtaat agattcaata       660
     taccaattga ataaaaaaca atcattgatc aaaaaaggca aacagtttga ttttcttgac       720
     ttcgacaatg aaaggaaacg cttaactgct ctttttcgta attctggaat tcggaatttt       780
     caagaaagct ccgtcaattt tgctatcacc agagattcaa caaagtccgg cacaaataaa       840
     aaaacagata tagcaataaa cattgataat cttagaacaa gaaacgataa taccatttca       900
     tcttcagaat ataaagttga aaggttcaaa caaataaata tctacacaga ttttattttg       960
     agcggtgatg aagagcaaaa caatgttgtt aaatacggta attacaatat atattacaag      1020
     gataaactca gatttaaacc gaaaaccttg accgatgcca ttttttttga aaaagatagt      1080
     atttatcgtg agtcggatag atcaagtacc taccggcgaa ttacaagttt gaatgttttt      1140
     aaataccctt caattgcttt tgacacagat agtctatcag gattgagcgc caatatatac      1200
     cttactgaac gccccaaata ttcacttggt atggagttag atgtttcaca ttctaacatt      1260
     caacaagtag gtatggcatt tagcccttct ttacaggtaa gaaacctatt caagggagcc      1320
     gaaaatttca gtttaaccgg cagaatgaac ataggttcat caaaagatga gagtattaga      1380
     gcttcggata gtcacttttt taatttattg gagtttggtg cggacgtaaa cctcactttt      1440
     ccaagaatct ggtttccgtt tataaaaacc gataaaataa tcccaaacta taccttgccc      1500
     caaacaaggt tgtcattagg tgccagttca caaaagaata ttggtttgga taaatggaca      1560
     ttcaacacgg ttttaggata taattggacg ccatctgact ttaaaaagca caatgtagaa      1620
     cttcttaata ttcaatttgt tgataattta aaaccatatc gttttttcaa tgtttatcag      1680
     aactcatatg atcgattaaa tgaaatagcc aacaaatatg atgaggcaaa tgaatttgat      1740
     gatccaaacg attatgaaac cttttccggg ttttatgaac catcagatga cccaaatgac      1800
     cctgacctaa gtatcccatc tggcaccgat ggttttattg atgaaataac cgataataca      1860
     gtacctgttt ccacggatga tttaaatgag gttagaagca ttgaggaaag aagggataga      1920
     ttaacagaga acaatctaat atttgccaca aactattctt ttagcaagca taaccaaaat      1980
     ggtattaccg acaatagttt tcaccgtttt aggttcaaag tagaaagtgc gggcaactta      2040
     ctttctgccc tgtcatatgt aatcccattc aatgagaaag atggtgatct tttggttttt      2100
     gatgtaccct actcccaata cattaaaaca gaatttgatt atatcaaata ttgggatttg      2160
     tcgcgatcca atgttttggc gttccgtagc ttttttggta tagccatacc ttatggcaat      2220
     tctgataaca ttccgttcgt ccgaagttat ttcgcaggtg gatcaaatga taatagagca      2280
     tggaacccat attcattagg tccgggaaag acaaatgaga tcaatgactt taatgaagca      2340
     aatttaaagt tggcatttaa cctcgaatat cgttttccag tggttggtga tataaaaggt      2400
     gcgcttttcg cagatgctgg taatatttgg aatgtctttg ataatgagga tgatccagac      2460
     aaaactttta atggcataga ttctttaacg gatattgcct tgggcactgg atttggtgtc      2520
     agatatgatt ttacgtattt cttgataaga gtagaccttg gtttcaaaac atacaatcca      2580
     gcagaagaaa tttcaaaaag atggtttagg gattataatt ttgccaattc cgtattacaa      2640
     attggtataa actatccttt ttag                                             2664
//

If you have problems or comments...

PBIL Back to PBIL home page