(data stored in ACNUC7421 zone)

EMBL: CP002157.PE133

CP002157.PE133       Location/Qualifiers
FT   CDS_pept        154762..155628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16796"
FT                   /product="acetyl-CoA carboxylase, carboxyl transferase
FT                   subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16796"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00762"
FT                   /db_xref="GOA:A4ATJ2"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATJ2"
FT                   /protein_id="EAR00762.1"
FT                   /translation="MEDMSSWFKRKEKGIQTATEQKKDTPKGLWYKSPTGKIVESEDLA
FT                   KNFYVSPEDDYHVRIGSKEYFEILFDDNKFTELDAKLYSKDPLKFTDTKKYTDRLKAAQ
FT                   KKTGLKDAVKTAIGKSNGKDLVIACMDFSFIGGSMGSVVGEKIARAIDHAIKKKVPFVM
FT                   ISKSGGARMMEAALSLMQLAKTSAKLAQLAEAKLPYISLCTDPTTGGTTASYAMLGDIN
FT                   ISEPGALIGFAGPRVVKEATGKDLPEGFQTSEFVQEHGFLDFITHRRDLKKKINLYIDL
FT                   IQNNPVR"
     atggaagata tgtcgtcgtg gtttaagaga aaagaaaaag gaatacaaac agctactgag        60
     cagaagaaag atacaccaaa aggtctttgg tataaatccc ctactggtaa gattgttgaa       120
     tctgaagatt tggccaaaaa cttctatgta agtccagagg atgactatca cgttcgcatt       180
     ggcagtaaag agtatttcga aattcttttc gacgataata aatttaccga gttagatgcc       240
     aaattatatt caaaagaccc gttaaaattc actgacacca aaaagtatac tgatcgttta       300
     aaagcagccc aaaagaaaac tggtttgaaa gacgccgtga aaacggcaat tggcaaatca       360
     aatggcaaag atttggtaat cgcttgtatg gattttagtt tcattggagg ttctatgggt       420
     agtgttgttg gtgagaaaat cgccagagcc atagatcatg ccattaaaaa gaaggtgcct       480
     tttgtaatga tttctaaatc gggtggtgct cgaatgatgg aagccgcact atctttaatg       540
     caattggcaa aaacctctgc gaaattagca cagctggccg aggcaaaact accgtacatt       600
     tctttatgca ctgatccaac aactggaggc actactgcat catatgcgat gttaggggat       660
     attaatattt ctgaaccagg tgccctaata ggttttgctg gtccacgcgt tgtgaaagaa       720
     gctacaggaa aggatttgcc tgaaggtttt caaacatcgg aatttgttca agaacatggg       780
     tttctggatt tcattacaca ccgaagggat ttaaagaaaa agataaatct ttatattgat       840
     ttgattcaaa acaatccagt cagataa                                           867
//

If you have problems or comments...

PBIL Back to PBIL home page