(data stored in ACNUC7421 zone)

EMBL: CP002157.PE134

CP002157.PE134       Location/Qualifiers
FT   CDS_pept        complement(155679..156539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16801"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16801"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00763"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATJ3"
FT                   /protein_id="EAR00763.1"
FT                   /translation="MKKNLRKVKFMGSLLLAICVLGSCDKDDSQNISEDMTITATELNA
FT                   SDEADLIIEDVVNIGEEVYATDEIMTTSKADYRSDYLPDCVTITTVLTSTSKEKSIDFG
FT                   EGCELPNGNILSGIIQLSYLKDMDLATKTLSMSLENFTFNGVAVDGNASIVRMRNNENG
FT                   NPESNAEADFEGNWPDGDSASFSANRTREWIEGYGSGYWGDNAFLISGKATYTGKLGNV
FT                   FMKETIVPLRRELSCRFIVSGILEISRNDATASLDFGDGSCDAKGILTHPDGESEEIFL
FT                   RRFKH"
     atgaaaaaga atttaagaaa agtgaagttt atgggatcat tgcttttggc aatttgtgtg        60
     ttgggatcct gcgacaaaga tgattctcag aacatttctg aagatatgac gattacagct       120
     acagaactaa atgcaagtga tgaggcagat ttaattattg aagatgttgt taatattggg       180
     gaagaagtct atgctactga tgaaataatg actacttcca aagctgatta cagatctgac       240
     tatttaccgg attgtgttac aataacaact gttttgacaa gtacaagcaa agaaaaatct       300
     attgattttg gagagggatg tgaattgcct aatggtaata tcctgagtgg gataatacaa       360
     ttaagctatt taaaggatat ggatttagct acaaagacat tgagtatgtc cctggagaat       420
     tttacgttca atggagtggc agttgacggg aatgcatcaa tagtaagaat gcgaaacaat       480
     gaaaatggca atcccgaatc caatgctgaa gccgattttg aaggtaattg gccagatgga       540
     gactcggcga gtttttcggc aaatagaaca cgcgaatgga ttgaagggta tggctcgggc       600
     tactggggtg ataatgcctt tttaatttcg ggtaaggcaa cgtatactgg taaattgggt       660
     aatgtgttca tgaaagagac tattgtgcct ttgcgtagag aattgtcctg taggtttatt       720
     gttagtggga ttcttgagat ttcgagaaat gatgctacag caagtcttga ttttggtgat       780
     ggttcgtgcg atgcaaaagg tattttgaca catcctgacg gagaatcaga ggaaatattt       840
     ttacgccggt tcaagcacta a                                                 861
//

If you have problems or comments...

PBIL Back to PBIL home page