(data stored in ACNUC7421 zone)

EMBL: CP002157.PE135

CP002157.PE135       Location/Qualifiers
FT   CDS_pept        156703..156972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16806"
FT                   /product="putative 30S ribosomal protein S15"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16806"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00764"
FT                   /db_xref="GOA:A4ATJ4"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATJ4"
FT                   /protein_id="EAR00764.1"
FT                   /translation="MYLTKEIKAEIFKKHGGKAENTGSTEGQVALFTHRINHLTGHLKN
FT                   NHKDYNTERSLVKLVGKRRSLLDYLKKKDIVKYRELIKELNIRK"
     atgtatctaa caaaagaaat caaagccgag attttcaaaa aacacggcgg aaaagcagag        60
     aacacaggtt ctacagaagg tcaagttgca ttgttcacac accgtatcaa tcatttgacc       120
     ggtcacctta aaaacaatca caaagattat aatactgagc gttcattggt gaaactggta       180
     ggtaaaagaa ggagtctttt agattacttg aagaaaaagg atattgtaaa atatcgtgaa       240
     cttatcaagg agcttaatat tagaaaataa                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page