(data stored in ACNUC7421 zone)

EMBL: CP002157.PE138

CP002157.PE138       Location/Qualifiers
FT   CDS_pept        160615..160845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16821"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16821"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00767"
FT                   /db_xref="GOA:A4ATJ7"
FT                   /db_xref="InterPro:IPR018668"
FT                   /db_xref="InterPro:IPR036361"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATJ7"
FT                   /protein_id="EAR00767.1"
FT                   /translation="MNNKQPNNPLHGIKLADILEYLVDTYSWEELASKININCFKSNPS
FT                   IKSSLKFLRRTPWAREKVEHLYLKSIKNNAS"
     atgaataaca aacaacccaa caacccattg cacggtatta aacttgctga cattcttgaa        60
     tatttagtag acacctatag ttgggaagaa ctagcatcca aaatcaatat caattgtttc       120
     aaaagcaatc catcaataaa atcgagtcta aaatttttgc gcagaacacc ttgggccaga       180
     gaaaaagtag aacatctata tttaaaatca attaaaaaca atgcctctta a                231
//

If you have problems or comments...

PBIL Back to PBIL home page