(data stored in ACNUC7421 zone)

EMBL: CP002157.PE151

CP002157.PE151       Location/Qualifiers
FT   CDS_pept        176062..176820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16886"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16886"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00780"
FT                   /db_xref="GOA:A4ATL0"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATL0"
FT                   /protein_id="EAR00780.1"
FT                   /translation="MSEQLKKMTEHQCSNTPAKYDDLKVLFLNCTLNRSPVLSHTEGLI
FT                   HIAQRIFEANGASTKIIRPVDYEIPAGLGLDMSKTPEWDKDDWPLIQKKIDTCDILIVC
FT                   TSVWLGEKSSVCNRTLERMYGYTHQFNEKGQYRDYGKVGATLITGNEDGVKHCAMNILF
FT                   SLSHIGYTVPPQADAGWMGEAGPGPSYRDEGSGGPENDFTNRNTTFLVWNCLHLARMLK
FT                   DQGGIPAHGNQPDEWQAGCKAGFDSPEHQR"
     atgtccgaac aactaaaaaa aatgaccgaa caccagtgtt ctaatacccc tgcaaaatat        60
     gatgatttaa aagtgctttt ccttaattgc actttgaata gaagcccagt tttatctcat       120
     acggaggggt tgattcacat tgcccaaaga atttttgaag caaacggtgc atcaaccaaa       180
     attatacgcc cagtagatta tgaaatacct gctggtttag gcctagacat gtctaaaact       240
     ccagaatggg ataaagatga ctggccattg attcaaaaaa aaatagatac ttgtgatatc       300
     ctaatcgttt gcacatcagt ttggttggga gaaaaatcat cggtttgtaa tagaaccttg       360
     gagcgtatgt atggttacac tcatcaattc aacgaaaaag gtcagtatag ggattatgga       420
     aaagtgggtg ctacgttgat tacgggaaat gaggatggtg ttaagcattg tgctatgaat       480
     attctctttt cattatcaca tataggctat acagttcctc cacaggcaga tgccggttgg       540
     atgggagaag caggtccagg gccatcatat agggatgagg gctccggagg acctgaaaac       600
     gatttcacga atagaaatac aacttttcta gtatggaatt gtctccactt agctcgaatg       660
     ttaaaagatc aaggaggaat accagcacat ggcaatcagc cagatgaatg gcaagctggt       720
     tgtaaggcag gttttgatag tcctgagcac cagcgctaa                              759
//

If you have problems or comments...

PBIL Back to PBIL home page