(data stored in ACNUC7421 zone)

EMBL: CP002157.PE156

CP002157.PE156       Location/Qualifiers
FT   CDS_pept        complement(182050..182769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16911"
FT                   /product="putative cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16911"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00785"
FT                   /db_xref="GOA:A4ATL5"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATL5"
FT                   /protein_id="EAR00785.1"
FT                   /translation="MRINWNYIKMIALLLVIMGLYAFSNHRSKEKSVKGLNIEFVGDQN
FT                   LYITQGMVNKLLIQNYGPLTNVPKENLVLNTIEKVIEANEMVKSAQVYLTVNGELTSKI
FT                   VQRKPIGRIEGNSKFYLDDEGKSMPLSMSHSARVPIITGKVTGKSLEDVYEILKYINQD
FT                   DFLRKNVIGIHIEDDERYQLKFRMEQFVVNLGGVDNLEEKFNNFKAFYVKANKDETLEE
FT                   YNVVSLEFNNQVVCTKI"
     atgcgaatta attggaatta cattaagatg attgctctat tacttgtgat tatggggctt        60
     tacgcgtttt ctaatcatag gagcaaggaa aaaagtgtta aggggctgaa tatagaattc       120
     gttggggatc agaaccttta cataactcag ggcatggtta ataaattgtt aatacaaaat       180
     tacggacccc tcacaaatgt gcccaaagaa aatttagttt tgaatactat agagaaggtc       240
     attgaggcca atgaaatggt gaaaagtgcc caagtttatc ttactgtaaa cggtgagctt       300
     acgtcaaaaa tcgtgcaacg caagccaatc ggacgaatcg aggggaattc taagttttat       360
     ctggatgatg aaggtaaaag tatgccatta tccatgagtc attctgctag agttccaata       420
     atcactggta aggtgacagg aaaaagtctt gaggatgttt atgagatttt aaagtacata       480
     aaccaagatg atttcttgag aaaaaatgtg ataggtattc atattgagga tgatgaaaga       540
     taccagttga agtttagaat ggagcagttt gtagtgaatt tgggaggagt tgataatcta       600
     gaggaaaagt tcaacaactt caaagcattt tatgtaaagg caaacaagga tgaaaccttg       660
     gaagaatata atgttgtgag cttagagttt aataatcaag tagtgtgcac caaaatataa       720
//

If you have problems or comments...

PBIL Back to PBIL home page