(data stored in ACNUC7421 zone)

EMBL: CP002157.PE159

CP002157.PE159       Location/Qualifiers
FT   CDS_pept        complement(185190..186389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16926"
FT                   /product="putative transmembrane rod-shape determining
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16926"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00788"
FT                   /db_xref="GOA:A4ATL8"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATL8"
FT                   /protein_id="EAR00788.1"
FT                   /translation="MLNFFKNIKGDKAIWAVVALLALFSFLPVYSASSNLVYVVGNGTT
FT                   SGHLIKHALLLFLGFGIIYGVHKIPAHFFKGLSLIAMPIVLVLLVFTLAQGTTIDGANA
FT                   SRWIRIPLVGFTFQTSNLAAVVLMIYVARYLTKIKDDVITFKESILPLWVPVFLVIILI
FT                   LPANFSTAAIIFSMVLLLCFLGGYPMKYLMGIIGTGILCLTIFVLTAKAAPDLFPNRVD
FT                   TWISRIENFSNPEDTEADYQIERAKIAVASGGIVGKGAGKSVQKNFLPQSSSDFIYAII
FT                   VEEYGLVGGFVLMFFYLLLLFRIVVVANGSQTIFGKLLVLGVGLPIVFQALINMAVAVE
FT                   LFPVTGQTLPLISSGGTSSWMTCLAIGIILSASRKSDILEREDTEIDDTNPLEVLSGQL
FT                   "
     gtgttgaatt tctttaaaaa tatcaaaggt gataaagcca tttgggccgt agtggcactt        60
     ctggccttgt tttcattttt gcccgtttat agtgcgagca gcaacttggt ctatgtagtt       120
     ggtaatggaa ctaccagtgg gcatttgatc aagcatgctc ttctgttgtt tttgggtttt       180
     ggaattattt atggtgtaca taagatacct gcacactttt ttaagggctt gtcattaatt       240
     gccatgccta ttgttttggt gttgttggta tttactttgg cgcaaggaac aactatcgat       300
     ggagctaatg ccagtaggtg gatacgtatt cctctggttg ggttcacttt tcaaacctca       360
     aatctagctg ctgttgtatt gatgatctat gtggctcgct atcttactaa aataaaagat       420
     gacgttataa cattcaaaga aagcattctt ccactatggg tcccggtttt cttggtgatt       480
     atacttattc tacctgccaa cttttcaact gctgcaatta tattttcaat ggttttacta       540
     ttgtgttttt taggaggtta tccgatgaaa tatttaatgg gtataatagg aacgggaata       600
     ttgtgcttaa ccatttttgt gttaacagct aaagcagcgc cagatttgtt tcctaaccgt       660
     gtggatactt ggataagcag aatagaaaat ttctcaaacc ctgaagatac cgaagctgat       720
     taccaaatag aaagagctaa aatagcagtt gcctctggag gaatagtggg taaaggtgcc       780
     ggtaaaagtg tgcaaaagaa ctttttgcca cagagttcat cagattttat atatgcgatt       840
     atagttgagg aatacggttt ggttggcggt tttgtgttga tgttcttcta tctgctattg       900
     ttgtttcgca tagtggtagt ggccaatggg agtcaaacta ttttcgggaa acttctagtt       960
     ttgggagttg gtctgcccat tgtttttcag gcgttgataa atatggcagt tgcggtagaa      1020
     ttatttccgg ttacaggtca gactttacca ctgatcagta gtggaggtac atcaagttgg      1080
     atgacatgtt tggcaatagg aattattctg agtgctagta gaaaaagcga cattttagag      1140
     agagaggata ctgaaattga tgatacaaat ccgttagaag tattaagtgg gcaattatag      1200
//

If you have problems or comments...

PBIL Back to PBIL home page