(data stored in ACNUC7421 zone)

EMBL: CP002157.PE163

CP002157.PE163       Location/Qualifiers
FT   CDS_pept        complement(190432..192438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16946"
FT                   /product="penicillin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16946"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00792"
FT                   /db_xref="GOA:A4ATM2"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATM2"
FT                   /protein_id="EAR00792.1"
FT                   /translation="MAVTEKSILTRLYVVAGCLFLFAGIVLFKLVSIQMVHGEKYRGLA
FT                   MKRTEKVFTIAPNRGNLYSDDGSLLATSVSRYTIRFDAVTVSDTDFKEQVKPLSNSLSK
FT                   LTGKTSSYYQQLLRKAKANKNRYTLLARNLDYSDYMSVKEFPLLNKGPYKGGLIVEQKT
FT                   VREHPLGKIAERSVGYERKDENGYYTRVGLEGAFGQYLRGVEGKRLKQKIAKGQWKPIG
FT                   MDNIIEPKDGYDVISTIDINIQDIAHHALLKQLEHYKADHGTVIVMETKTGEVKAISNL
FT                   GMTKEGKYYERLNYAIGESHEPGSTFKLMNMVAALEDAVIDTSAVVDTGKGSWKIYKHR
FT                   VKDSKHGGYGKISFAKAFEVSSNTAFAQVIHNNYKENPERYVNRLRGMQLHQELGLPIK
FT                   GEGTPVLRNPGDKGWSGLSLAQMAYGYEVSMTPLQVLTFYNAIANDGEMVKPRMIKEVK
FT                   EWNRSVIKFEKEVINPSICSEETAAKVKQLLKNVVEKKHGTGHKLYSPNFSMAGKTGTA
FT                   QKNYVSKDPDKLRYISTFAGYFPAEEPKYSCIVVIHEPDKSVGYYGADVSGPVFKSVAQ
FT                   KVYATNPLIDEVQMLNSENQKLDESYQKYYVEAQKKYNKVPNVKGMCGMDAVSILENLG
FT                   IKVEVRGNGKVKKQSISHGTDINKVDKIVLDLS"
     atggcagtta ccgagaaaag catattgacc aggttgtacg ttgtggcggg ttgtctattc        60
     ctgtttgctg gtatagtgct ttttaaattg gtgagtattc agatggtaca tggtgaaaag       120
     tacaggggtc ttgccatgaa acgaacggaa aaagtattta ctatagctcc aaatcgagga       180
     aatctatatt ctgatgatgg cagccttttg gccacatcag tatcaaggta tactattcgt       240
     tttgatgctg ttacagttag tgataccgat tttaaagagc aggtcaaacc attatccaac       300
     tctttgtcca agcttacagg caaaacatct tcctattacc aacaactttt acgaaaggca       360
     aaagcaaata aaaacaggta tacactttta gcaagaaatc ttgattattc cgattatatg       420
     tcggtcaagg agttcccttt attgaataaa gggccttata aaggtgggtt gatcgttgag       480
     cagaaaacag taagagagca tccgttaggt aaaattgctg aaagaagtgt tgggtacgaa       540
     cgtaaagatg aaaacggtta ttacactagg gttggacttg aaggtgcttt tggacaatat       600
     ttgcgagggg ttgaaggtaa acgtcttaag cagaaaattg ccaaaggaca atggaagcct       660
     atcgggatgg ataatattat tgagcctaaa gacggttatg atgtaatatc cacaatcgat       720
     attaatattc aagatattgc ccatcacgcc cttttaaaac aattggagca ttataaagcg       780
     gaccacggta ccgtgattgt gatggaaacc aaaacaggtg aagttaaggc gatttccaat       840
     ttaggaatga ccaaagaagg taagtactat gagcgcttga actatgccat cggtgagtcc       900
     catgaaccgg gttctacttt caaattaatg aatatggttg ctgcgcttga agatgcggtt       960
     atcgatacca gtgcagtcgt agatacgggt aagggatctt ggaaaatata taagcaccgt      1020
     gtcaaagatt ccaagcatgg tgggtatggt aaaatttctt ttgccaaagc atttgaagtt      1080
     tcctcaaata cggcatttgc ccaagtcatt cataataatt ataaagaaaa tcctgaaaga      1140
     tatgttaacc gtttgcgagg tatgcaatta catcaagaat tggggcttcc gataaaaggc      1200
     gaggggacac ctgtactccg taatcctggt gataaagggt ggtcagggct ttcattagca      1260
     caaatggcat atggttatga ggtctcaatg acaccattgc aggtactcac attctataat      1320
     gcaatcgcca atgatgggga aatggtaaaa ccccgaatga taaaagaggt aaaagaatgg      1380
     aataggtcgg ttattaaatt tgaaaaagag gttatcaacc cttcaatatg ttcggaagag      1440
     accgctgcaa aagtgaaaca attattgaaa aatgttgtgg agaaaaagca tggtacgggt      1500
     cataaactgt attctcccaa cttctcaatg gcaggaaaga caggtacagc tcagaaaaac      1560
     tatgtttcta aagacccaga taaattaagg tacatatcaa cttttgctgg ttatttcccg      1620
     gcagaagaac caaagtactc ttgtattgta gttattcatg aacctgataa aagtgttggg      1680
     tattatggtg ctgatgtatc aggtcctgtt tttaaatctg tggcgcaaaa agtttatgcg      1740
     accaacccat tgattgatga ggttcagatg ctgaattctg agaatcaaaa attggacgag      1800
     tcctatcaga aatactatgt ggaagcccag aaaaaataca ataaggtgcc gaatgtaaaa      1860
     ggaatgtgtg gaatggatgc tgtgtcaatc cttgagaacc tcggaatcaa agttgaagtt      1920
     cggggcaatg gaaaagttaa gaagcaatct atttcgcacg gaacggatat taataaagtg      1980
     gataaaatcg tattggatct ttcatga                                          2007
//

If you have problems or comments...

PBIL Back to PBIL home page