(data stored in ACNUC7421 zone)

EMBL: CP002157.PE166

CP002157.PE166       Location/Qualifiers
FT   CDS_pept        complement(193649..194119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16961"
FT                   /product="mraZ protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16961"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00795"
FT                   /db_xref="GOA:A4ATM5"
FT                   /db_xref="InterPro:IPR003444"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR020603"
FT                   /db_xref="InterPro:IPR035642"
FT                   /db_xref="InterPro:IPR035644"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR038619"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATM5"
FT                   /protein_id="EAR00795.1"
FT                   /translation="MNFNEAYYCKADAKGRVMLPSALKNRLLPVLKDGFVLKRSVSGAC
FT                   LELWPMSRWNDMMLNIKKLNRFVKKNNDFIRIFMAGVKEVEIDNAGRLLIPKNLMGIAG
FT                   ITKEIALSPSIDIIEIWDQNNYEKAIKISDKEFEVLAEEVMGDFGENIPDVS"
     atgaatttta acgaagcata ttattgtaaa gctgatgcca aaggtagggt aatgttgcct        60
     tctgccctaa aaaataggtt attgcctgtt ttgaaagatg gtttcgttct gaaacgatca       120
     gtgagtggag catgcttgga attgtggcca atgtcccgat ggaatgatat gatgttgaac       180
     attaaaaaat tgaatcgttt cgtcaaaaaa aacaatgact ttatccgcat ttttatggct       240
     ggggtaaagg aggttgaaat tgacaatgcc ggtaggttgt tgattccgaa gaatttaatg       300
     ggaattgctg gtatcacgaa ggaaatagca ttaagcccgt ctattgatat tatagaaata       360
     tgggaccaga ataattacga aaaggccatt aagatttcag ataaggagtt cgaagttttg       420
     gccgaggagg taatgggtga ttttggagaa aatattcccg atgtatcata a                471
//

If you have problems or comments...

PBIL Back to PBIL home page