(data stored in ACNUC7421 zone)

EMBL: CP002157.PE167

CP002157.PE167       Location/Qualifiers
FT   CDS_pept        194229..194369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16966"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16966"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00796"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATM6"
FT                   /protein_id="EAR00796.1"
FT                   /translation="MGWLLNSNEIMFSFNFGGIVRRISQPSNYNMAAMDRNFEELPIFA
FT                   N"
     atgggatggt tattgaattc gaatgagatt atgttttcgt tcaactttgg aggcattgtt        60
     cgaagaatat cccaaccttc caattacaat atggcagcaa tggacaggaa ttttgaggaa       120
     ttgcctatat ttgccaatta a                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page