(data stored in ACNUC7421 zone)

EMBL: CP002157.PE169

CP002157.PE169       Location/Qualifiers
FT   CDS_pept        195163..195774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16976"
FT                   /product="putative GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16976"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00798"
FT                   /db_xref="GOA:A4ATM8"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATM8"
FT                   /protein_id="EAR00798.1"
FT                   /translation="MKIKSADFVMSNSDVAKCPNEPLPEYAFIGRSNVGKSSLINMLTE
FT                   RKSLAKTSGRPGKTQLINHFKINGNWFLVDLPGYGYARVSKKDKRTFQKYITDYFIKRK
FT                   QLVSAFVLVDIRHEPQKVDMEFMEYLGENMIPFSIIFTKADKLKPKQMEANVNSYVKEL
FT                   LNGVWEEAPNYFVTSSSKNMGRDELLHYIESINQEFFKEN"
     atgaaaataa agtcggcaga ctttgtaatg agcaattccg atgttgccaa atgccctaat        60
     gaacctttac ctgagtatgc ttttatagga cgttcaaatg taggtaagtc ttcgctcatt       120
     aatatgttga ccgaacgtaa aagtctcgcc aaaacctcgg gaagacctgg aaaaacacag       180
     ctcataaacc atttcaaaat aaatggcaat tggtttctgg tagatttacc aggctatggc       240
     tacgcccgtg tttcaaaaaa ggacaaaagg acttttcaaa aatatatcac cgactatttt       300
     ataaagcgca agcaattggt cagcgccttt gtcttggtag atattcgtca tgaaccccaa       360
     aaggttgaca tggagtttat ggaataccta ggagaaaaca tgattccttt tagcatcatt       420
     ttcacaaaag cagataaatt gaaacccaag caaatggagg ctaatgtgaa ttcctatgtc       480
     aaggaattgc tcaatggtgt ttgggaagaa gcacctaatt actttgttac ttcctcctca       540
     aaaaatatgg gcagagacga actcttacac tacatagaaa gtataaatca agaattcttc       600
     aaagaaaact ag                                                           612
//

If you have problems or comments...

PBIL Back to PBIL home page