(data stored in ACNUC7421 zone)

EMBL: CP002157.PE173

CP002157.PE173       Location/Qualifiers
FT   CDS_pept        complement(199350..199685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16996"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16996"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00802"
FT                   /db_xref="InterPro:IPR019854"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATN2"
FT                   /protein_id="EAR00802.1"
FT                   /translation="MAKSHTSEITLKVGLDENRVPEELTWSAEDGGINNEDAKAMLLSV
FT                   WDSKNQESLKIDLWTKDMPVDEMKVFFHQTLVSLSDTFMKATQDEKMTATMKDFCDYFA
FT                   EKLELKK"
     atggcaaaat cacacacatc ggagataact ttaaaggtgg gattagatga aaatcgtgtt        60
     cctgaagaac taacttggtc tgcagaagat ggaggtatca ataacgaaga cgcaaaagct       120
     atgcttttat ctgtttggga tagtaaaaac caagaatctt tgaaaattga tttatggaca       180
     aaggatatgc ccgttgatga gatgaaggtg ttttttcatc aaacattggt atctctttcc       240
     gatacgttta tgaaggccac gcaggatgaa aaaatgacgg ccacaatgaa agatttctgt       300
     gattattttg cagaaaaatt ggaattgaaa aagtaa                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page