(data stored in ACNUC7421 zone)

EMBL: CP002157.PE174

CP002157.PE174       Location/Qualifiers
FT   CDS_pept        complement(199686..200642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17001"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17001"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00803"
FT                   /db_xref="InterPro:IPR019853"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATN3"
FT                   /protein_id="EAR00803.1"
FT                   /translation="MKNPFYLLLVFLIIITGCESEDKVSEEVSKMSLDLKVSRFDNEFA
FT                   NASPVDIPKLRKEYPYLFPAPDSVWIAKLQDSLQMELREEVKVEFSDFEKEKADIELLF
FT                   KYIKYYFPKYEVPRVITVTNTVDYNNRIVLADSLLLIGLDNYLGAEHKYYRELQNYIAS
FT                   DMNRDYIVSNAANAFANKVVSRPRERTFLAQLIYQGKVLYLKDKIMPFHSDEQKITYSE
FT                   DELTWAQLNEEPMWRYFIERELLYSTDSKLSQQFLDPAPFSKFGLELDNESPGQLGRFL
FT                   GWQIVRSFMEKNDVSLQHLMNFSAEEIFKKSNYKPKK"
     atgaagaacc cattttattt attattggta tttctaatta ttattactgg ttgtgaatcg        60
     gaagataagg tcagtgaaga agttagcaag atgtctttgg atttaaaagt gtcaagattt       120
     gataatgaat ttgccaatgc ttcgccggtt gatattccaa aacttagaaa agaataccct       180
     tatttatttc ccgcccctga tagtgtctgg attgcaaaac tacaggactc actgcaaatg       240
     gaattacggg aagaagtaaa ggttgaattt agcgactttg aaaaagagaa ggcagatatt       300
     gagttgttgt ttaagtatat aaaatactat ttcccaaaat atgaggtgcc tagggtaatt       360
     acggttacta acacagtaga ctataataac cgcatagttt tggccgatag cttattactt       420
     attggactgg ataattacct gggagcagag cataagtatt atagggagtt gcagaactac       480
     atcgcttcgg atatgaatcg tgattatatt gttagtaacg cggcaaatgc atttgccaat       540
     aaagtcgttt cacgtccaag agaaagaact ttcctggcgc aattgattta tcagggtaaa       600
     gtattatatc taaaagataa aataatgccc tttcattcag atgaacaaaa gataacatat       660
     tcggaagatg aattgacatg ggctcagctt aatgaagaac ctatgtggag gtattttatt       720
     gaacgcgaat tattatatag tacggatagt aaattgtcac aacaattttt agacccggcc       780
     cccttttcta aattcggctt ggaactggac aatgagtccc ctggccaatt gggacgtttt       840
     ttaggatggc agattgttcg gtcttttatg gaaaagaatg atgtttcttt acaacattta       900
     atgaactttt cggcggaaga aatctttaaa aaatccaact acaaaccaaa gaaataa          957
//

If you have problems or comments...

PBIL Back to PBIL home page